MED6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MED6 Antibody [NBP2-38118] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry: MED6 Antibody [NBP2-38118] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED6 Protein (NBP2-38118PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED6 Antibody

  • Activator-recruited cofactor 33 kDa component
  • ARC33
  • mediator complex subunit 6hMed6
  • mediator of RNA polymerase II transcription subunit 6
  • mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 6 homolog
  • NY-REN-28
  • Renal carcinoma antigen NY-REN-28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu
Applications: WB, IHC, IHC-P, IP, KD
H00009412-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56318
Species: Hu
Applications: ICC/IF
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBL1-11392
Species: Hu
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP3-04662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
NBP2-92972
Species: Hu, Mu, Rt
Applications: WB, IP, KO
NB100-61060
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
NBP1-89014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009440-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00009443-M01
Species: Hu
Applications: WB, ELISA, S-ELISA, KD
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-45294
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IF
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, PEP-ELISA, KD
NBP1-85104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD

Publications for MED6 Antibody (NBP2-38118) (0)

There are no publications for MED6 Antibody (NBP2-38118).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED6 Antibody (NBP2-38118) (0)

There are no reviews for MED6 Antibody (NBP2-38118). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED6 Antibody (NBP2-38118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MED6 Products

Bioinformatics Tool for MED6 Antibody (NBP2-38118)

Discover related pathways, diseases and genes to MED6 Antibody (NBP2-38118). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED6 Antibody (NBP2-38118)

Discover more about diseases related to MED6 Antibody (NBP2-38118).
 

Pathways for MED6 Antibody (NBP2-38118)

View related products by pathway.

PTMs for MED6 Antibody (NBP2-38118)

Learn more about PTMs related to MED6 Antibody (NBP2-38118).

Blogs on MED6

There are no specific blogs for MED6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED6
Uniprot