MED4 Antibody - BSA Free

Western Blot: MED4 Antibody [NBP1-84977] - Components from all modules of Mediator are found in TAP-wtICP4 samples. Western blot analysis of nuclear extracts (NE) or affinity purified (PD) samples using either wtICP4 (KOS) or TAP-wtICP4 (TAP) expressing viruses at 6 hpi. Results of the Western blot analysis for components of the head (Med6), middle (Med4 and Med1), tail (Med23), kinase (cdk8, Med12, and Med13), and the Med26 protein are shown. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0078242), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: MED4 Antibody [NBP1-84977] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Placenta shows strong nuclear positivity in trophoblastic cells.

Western Blot: MED4 Antibody [NBP1-84977] - Analysis in control (vector only transfected HEK293T lysate) and MED4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Lymph node shows moderate nuclear positivity in non-germinal center and germinal center cells.

Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Pm, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MED4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQI
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
• Application Notes: WB reported in scientific literature (PMID: 24147125). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MED4 Protein (NBP1-84977PEP)

Reactivity Notes

Primate reactivity reported in the scientific literature (PMID: 26067369).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MED4 Antibody - BSA Free

• Activator-recruited cofactor 36 kDa component
• ARC36
• DRIP36
• DRIP36mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae)
• FLJ10956
• HSPC126
• HSPC126vitamin D receptor interacting protein
• MED4
• mediator complex subunit 4TRAP/SMCC/PC2 subunit p36 subunit
• subunit 4 homolog
• TRAP36
• VDRIP

Background

MED4 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymera

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MED4 Antibody (NBP1-84977)(1)

Publication using NBP1-84977

• Wagner LM, Deluca NA Temporal Association of Herpes Simplex Virus ICP4 with Cellular Complexes Functioning at Multiple Steps in PolII Transcription PLoS One 2013-10-11 [PMID: 24147125] (WB, Primate)
  
  Details:
  Chlorocebus pygerythrus (Vervet monkey)

Bioinformatics

• Gene Symbol: MED4