MED4 Antibody

Images

 
Western Blot: MED4 Antibody [NBP1-84977] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: MED4 Antibody [NBP1-84977] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MED4 Antibody [NBP1-84977] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED4 Protein (NBP1-84977PEP)
Publications
Read Publication using
NBP1-84977 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED4 Antibody

  • Activator-recruited cofactor 36 kDa component
  • ARC36
  • DRIP36
  • DRIP36mediator of RNA polymerase II transcription, subunit 4 homolog (S. cerevisiae)
  • FLJ10956
  • HSPC126
  • HSPC126vitamin D receptor interacting protein
  • MED4
  • mediator complex subunit 4TRAP/SMCC/PC2 subunit p36 subunit
  • subunit 4 homolog
  • TRAP36
  • VDRIP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-24393
Species: Hu
Applications: WB
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP1-87006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-89014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00009443-M01
Species: Hu
Applications: WB, ELISA
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for MED4 Antibody (NBP1-84977)(1)

We have publications tested in 1 confirmed species: Primate.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Primate
(1)
All Species

Reviews for MED4 Antibody (NBP1-84977) (0)

There are no reviews for MED4 Antibody (NBP1-84977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED4 Antibody (NBP1-84977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED4 Products

Bioinformatics Tool for MED4 Antibody (NBP1-84977)

Discover related pathways, diseases and genes to MED4 Antibody (NBP1-84977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED4 Antibody (NBP1-84977)

Discover more about diseases related to MED4 Antibody (NBP1-84977).
 

Pathways for MED4 Antibody (NBP1-84977)

View related products by pathway.

PTMs for MED4 Antibody (NBP1-84977)

Learn more about PTMs related to MED4 Antibody (NBP1-84977).
 

Research Areas for MED4 Antibody (NBP1-84977)

Find related products by research area.

Blogs on MED4

There are no specific blogs for MED4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED4
Entrez