MED20 Antibody

Images

 
Western Blot: MED20 Antibody [NBP1-84140] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: MED20 Antibody [NBP1-84140] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & centrosome.
Immunohistochemistry-Paraffin: MED20 Antibody [NBP1-84140] - Staining of human colon shows moderate cytoplasmic and membrane positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED20 Protein (NBP1-84140PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED20 Antibody

  • hTRFP
  • mediator complex subunit 20MGC29869
  • mediator of RNA polymerase II transcription subunit 20
  • PRO0213
  • Trf (TATA binding protein-related factor)-proximal homolog (Drosophila)
  • Trf (TATA binding protein-related factor)-proximal homolog
  • TRFPDKFZp586D2223
  • TRF-proximal protein homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17257
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38118
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-87006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051003-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
MAB6798
Species: Hu
Applications: WB, ICC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
H00009440-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP1-89018
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34162
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MED20 Antibody (NBP1-84140) (0)

There are no publications for MED20 Antibody (NBP1-84140).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED20 Antibody (NBP1-84140) (0)

There are no reviews for MED20 Antibody (NBP1-84140). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED20 Antibody (NBP1-84140) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED20 Products

Bioinformatics Tool for MED20 Antibody (NBP1-84140)

Discover related pathways, diseases and genes to MED20 Antibody (NBP1-84140). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED20 Antibody (NBP1-84140)

Discover more about diseases related to MED20 Antibody (NBP1-84140).
 

Pathways for MED20 Antibody (NBP1-84140)

View related products by pathway.

Blogs on MED20

There are no specific blogs for MED20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED20