MED9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MED9 Antibody [NBP2-31639] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry: MED9 Antibody [NBP2-31639] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED9 Protein (NBP2-31639PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED9 Antibody

  • FLJ10193mediator of RNA polymerase II transcription, subunit 9 homolog
  • MED25mediator of RNA polymerase II transcription subunit 9
  • mediator complex subunit 9MGC138234
  • mediator of RNA polymerase II transcription, subunit 9 homolog (S. cerevisiae)
  • mediator subunit 25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NB200-338
Species: Hu, Mu
Applications: WB (-), IP
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-89612
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009441-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-90034
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF3075
Species: Hu
Applications: WB, ICC
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49942
Species: Hu, Mu
Applications: WB, IP
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-31639
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MED9 Antibody (NBP2-31639) (0)

There are no publications for MED9 Antibody (NBP2-31639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED9 Antibody (NBP2-31639) (0)

There are no reviews for MED9 Antibody (NBP2-31639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED9 Antibody (NBP2-31639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED9 Products

Bioinformatics Tool for MED9 Antibody (NBP2-31639)

Discover related pathways, diseases and genes to MED9 Antibody (NBP2-31639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED9 Antibody (NBP2-31639)

Discover more about diseases related to MED9 Antibody (NBP2-31639).
 

Pathways for MED9 Antibody (NBP2-31639)

View related products by pathway.

PTMs for MED9 Antibody (NBP2-31639)

Learn more about PTMs related to MED9 Antibody (NBP2-31639).

Blogs on MED9

There are no specific blogs for MED9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED9
Uniprot