MED17 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MED17 Antibody [NBP2-57476] - Staining of human cell line SiHa shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED17 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKR
Specificity
Specificity of human MED17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED17
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED17 Recombinant Protein Antigen (NBP2-57476PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MED17 Antibody

  • Activator-recruited cofactor 77 kDa component
  • Cofactor required for Sp1 transcriptional activation subunit 6
  • cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa
  • CRSP6FLJ10812
  • CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD)
  • DRIP77
  • DRIP80ARC77
  • mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component
  • mediator of RNA polymerase II transcription subunit 17
  • Thyroid hormone receptor-associated protein complex 80 kDa component
  • Transcriptional coactivator CRSP77
  • Trap80
  • TRAP80CRSP complex subunit 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5520
Species: Hu, Mu
Applications: WB
NBP2-83187
Species: Hu
Applications: WB, ChIP
NBP1-91189
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP, ChIP
H00010001-D01P
Species: Hu, Mu
Applications: WB
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-337
Species: Hu, Mu
Applications: WB (-), ChIP, IP
H00009443-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
NBP1-87818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, PEP-ELISA, KD
NBP2-34162
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
NBP1-98585
Species: Rt
Applications: WB
NB100-74599
Species: Hu, Mu
Applications: WB, IP
NBP2-67401
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MED17 Antibody (NBP2-57476) (0)

There are no publications for MED17 Antibody (NBP2-57476).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED17 Antibody (NBP2-57476) (0)

There are no reviews for MED17 Antibody (NBP2-57476). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED17 Antibody (NBP2-57476) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MED17 Products

Bioinformatics Tool for MED17 Antibody (NBP2-57476)

Discover related pathways, diseases and genes to MED17 Antibody (NBP2-57476). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED17 Antibody (NBP2-57476)

Discover more about diseases related to MED17 Antibody (NBP2-57476).
 

Pathways for MED17 Antibody (NBP2-57476)

View related products by pathway.

PTMs for MED17 Antibody (NBP2-57476)

Learn more about PTMs related to MED17 Antibody (NBP2-57476).
 

Research Areas for MED17 Antibody (NBP2-57476)

Find related products by research area.

Blogs on MED17

There are no specific blogs for MED17, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED17