MED11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MED11 Antibody [NBP2-34162] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MED11 Antibody [NBP2-34162] - Staining of human rectum shows strong cytoplasmic positivity in subset of glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLE
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED11 Protein (NBP2-34162PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED11 Antibody

  • Mediator Complex Subunit 11
  • Mediator Of RNA Polymerase II Transcription Subunit 11
  • Mediator Of RNA Polymerase II Transcription, Subunit 11 Homolog (S.Cerevisiae)
  • Mediator Of RNA Polymerase II Transcription, Subunit 11 Homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81328
Species: Hu
Applications: ICC/IF, WB
H00009440-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-89014
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87818
Species: Hu
Applications: IHC, IHC-P, WB
H00010001-D01P
Species: Hu, Mu
Applications: WB
NB100-61060
Species: Hu, Mu, V-Vi
Applications: ChIP, IP, WB
NBP1-85104
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-17257
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84140
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009443-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP1-84977
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBL1-11392
Species: Hu
Applications: WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP3-04662
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP2-34162
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MED11 Antibody (NBP2-34162) (0)

There are no publications for MED11 Antibody (NBP2-34162).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED11 Antibody (NBP2-34162) (0)

There are no reviews for MED11 Antibody (NBP2-34162). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED11 Antibody (NBP2-34162) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MED11 Products

Array NBP2-34162

Bioinformatics Tool for MED11 Antibody (NBP2-34162)

Discover related pathways, diseases and genes to MED11 Antibody (NBP2-34162). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED11 Antibody (NBP2-34162)

Discover more about diseases related to MED11 Antibody (NBP2-34162).
 

Pathways for MED11 Antibody (NBP2-34162)

View related products by pathway.

PTMs for MED11 Antibody (NBP2-34162)

Learn more about PTMs related to MED11 Antibody (NBP2-34162).

Blogs on MED11

There are no specific blogs for MED11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED11
Uniprot