MED14 Antibody - BSA Free

Western Blot: MED14 Antibody [NBP3-05055] - Analysis of extracts of various cell lines, using MED14 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MED14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MED14 Antibody - BSA Free (NBP3-05055) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 470-650 of human MED14 (NP_004220.2). LDQATLDDMEKSVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFIKLTRLPQYYIVVEMLEVPNKPTQLSYKYYFMSVNAADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVESKKTKRAGEMCAFNKVLAHFVAMCDT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 160 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MED14 Antibody - BSA Free

• Activator-recruited cofactor 150 kDa component
• ARC150
• Cofactor required for Sp1 transcriptional activation subunit 2
• cofactor required for Sp1 transcriptional activation, subunit 2 (150kD)
• CRSP150
• CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa
• CSRP
• CXorf4MGC104513
• EXLM1CRSP complex subunit 2
• human homolog of yeast RGR1
• mediator complex subunit 14DRIP150
• mediator of RNA polymerase II transcription subunit 14
• RGR1RGR1 homolog
• Thyroid hormone receptor-associated protein complex 170 kDa component
• thyroid hormone receptor-associated protein complex component TRAP170
• Transcriptional coactivator CRSP150
• transcriptional co-activator CRSP150
• Trap170
• TRAP170hRGR1
• vitamin D receptor-interacting protein complex component DRIP150
• Vitamin D3 receptor-interacting protein complex 150 kDa component

Background

The activation of gene transcription is a multi-step process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multi-subunit complexes e.g. thyroid hormone receptor (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED14