Calponin 1 Antibody - BSA Free

Analysis in human prostate and tonsil tissues Corresponding CNN1 RNA-seq data are presented for the same tissues.

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Staining of human rectum shows strong cytoplasmic positivity in smooth muscle cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human prostate tissue.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calponin 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Calponin 1 Antibody - BSA Free (NBP1-87029) is a polyclonal antibody validated for use in IHC and WB. Anti-Calponin 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Calponin 1 Recombinant Protein Antigen (NBP1-87029PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Calponin 1 Antibody - BSA Free

• Basic calponin
• Calponin 1
• calponin 1, basic, smooth muscle
• Calponin H1
• Calponin H1, smooth muscle
• calponins, basic
• CNN1
• Sm-Calp
• SMCC
• SMCCcalponin-1

Background

Calponin is a smooth muscle specific, actin-, tropomyosin- and calmodulin-binding protein thought to be involved in regulation of actomyosin as well as the regulation or modulation of contraction (1). Calponin binds filamentous actin (F-actin) through two distinct sites ABS1 and ABS2, with an affinity in the low micromolar range (2) Immunoreactivity for calponin, along with alpha-smooth muscle actin and smooth muscle myosin heavy chains, confirms the known neoplastic myoepithelial component of adenoid cystic carcinomas and epithelial-myoepithelial carcinomas. The consistently positive staining pattern in adenoid cystic carcinomas may be diagnostically useful in discriminating histologically similar but consistently negative polymorphous low-grade adenocarcinomas (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calponin 1 Antibody (NBP1-87029)(1)

Publication using NBP1-87029

• Lien M. Reolizo, Helen Williams, Kerry Wadey, Aleksandra Frankow, Ze Li, Kevin Gaston, Padma-Sheela Jayaraman, Jason L. Johnson, Sarah J. George Inhibition of Intimal Thickening By PRH (Proline-Rich Homeodomain) in Mice Arteriosclerosis, Thrombosis, and Vascular Biology 2023-01-26 [PMID: 36700427]

Bioinformatics

• Gene Symbol: CNN1