Calponin 1 Antibody

Images

 
Western Blot: Calponin 1 Antibody [NBP1-87029] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Calponin 1 Antibody [NBP1-87029] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calponin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Calponin 1 Protein (NBP1-87029PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calponin 1 Antibody

  • Basic calponin
  • Calponin 1
  • calponin 1, basic, smooth muscle
  • Calponin H1
  • Calponin H1, smooth muscle
  • calponins, basic
  • CNN1
  • Sm-Calp
  • SMCC
  • SMCCcalponin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP1-85885
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-56318
Species: Hu
Applications: ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-24393
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87029
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Calponin 1 Antibody (NBP1-87029) (0)

There are no publications for Calponin 1 Antibody (NBP1-87029).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calponin 1 Antibody (NBP1-87029) (0)

There are no reviews for Calponin 1 Antibody (NBP1-87029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calponin 1 Antibody (NBP1-87029) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calponin 1 Products

Bioinformatics Tool for Calponin 1 Antibody (NBP1-87029)

Discover related pathways, diseases and genes to Calponin 1 Antibody (NBP1-87029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calponin 1 Antibody (NBP1-87029)

Discover more about diseases related to Calponin 1 Antibody (NBP1-87029).
 

Pathways for Calponin 1 Antibody (NBP1-87029)

View related products by pathway.

PTMs for Calponin 1 Antibody (NBP1-87029)

Learn more about PTMs related to Calponin 1 Antibody (NBP1-87029).
 

Research Areas for Calponin 1 Antibody (NBP1-87029)

Find related products by research area.

Blogs on Calponin 1

There are no specific blogs for Calponin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calponin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNN1
Entrez