MCM4 Antibody

Images

 
Western Blot: MCM4 Antibody [NBP1-85728] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MCM4 Antibody [NBP1-85728] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MCM4 Antibody [NBP1-85728] - Staining of human lymph node shows strong nuclear positivity in cells in reaction center.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCM4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCM4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
MCM4 Protein (NBP1-85728PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCM4 Antibody

  • CDC21 homolog
  • CDC21
  • CDC54
  • DNA replication licensing factor MCM4
  • EC 3.6.4.12
  • hCdc21
  • homolog of S. pombe cell devision cycle 21
  • MCM4 minichromosome maintenance deficient 4 (S. cerevisiae)
  • MCM4 minichromosome maintenance deficient 4
  • MGC33310
  • minichromosome maintenance complex component 4
  • minichromosome maintenance deficient 4
  • P1-Cdc21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-01184
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for MCM4 Antibody (NBP1-85728) (0)

There are no publications for MCM4 Antibody (NBP1-85728).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM4 Antibody (NBP1-85728) (0)

There are no reviews for MCM4 Antibody (NBP1-85728). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MCM4 Antibody (NBP1-85728) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCM4 Products

Bioinformatics Tool for MCM4 Antibody (NBP1-85728)

Discover related pathways, diseases and genes to MCM4 Antibody (NBP1-85728). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM4 Antibody (NBP1-85728)

Discover more about diseases related to MCM4 Antibody (NBP1-85728).
 

Pathways for MCM4 Antibody (NBP1-85728)

View related products by pathway.

PTMs for MCM4 Antibody (NBP1-85728)

Learn more about PTMs related to MCM4 Antibody (NBP1-85728).
 

Research Areas for MCM4 Antibody (NBP1-85728)

Find related products by research area.

Blogs on MCM4

There are no specific blogs for MCM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM4