MCM4 Antibody - BSA Free

Immunohistochemistry-Paraffin: MCM4 Antibody [NBP1-85728] - Analysis in human testis and pancreas tissues. Corresponding MCM4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MCM4 Antibody [NBP1-85728] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: MCM4 Antibody [NBP1-85728] - Staining of human pancreas shows low positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: MCM4 Antibody [NBP1-85728] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: MCM4 Antibody [NBP1-85728] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.

Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MCM4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Staining of human cell line U-2 OS shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MCM4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MCM4 Antibody - BSA Free (NBP1-85728) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSAT
• Predicted Species: Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCM4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
• Control Peptide:

  MCM4 Protein (NBP1-85728PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MCM4 Antibody - BSA Free

• CDC21 homolog
• CDC21
• CDC54
• DNA replication licensing factor MCM4
• EC 3.6.4.12
• hCdc21
• homolog of S. pombe cell devision cycle 21
• IMD54
• MCM4 minichromosome maintenance deficient 4 (S. cerevisiae)
• MCM4 minichromosome maintenance deficient 4
• MCM4
• MGC33310
• minichromosome maintenance complex component 4
• minichromosome maintenance deficient 4
• NKCD
• NKGCD
• P1-CDC21

Background

MCM4 is encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MCM4