MCM2 Antibody (6A8)

Images

 
Western Blot: MCM2 Antibody (6A8) [H00004171-M01] - MCM2 monoclonal antibody (M01), clone 6A8 Analysis of MCM2 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: MCM2 Antibody (6A8) [H00004171-M01] - Analysis of monoclonal antibody to MCM2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: MCM2 Antibody (6A8) [H00004171-M01] - Analysis of MCM2 expression in transfected 293T cell line by MCM2 monoclonal antibody (M01), clone 6A8.Lane 1: MCM2 transfected lysate(101.9 KDa).Lane 2: ...read more
Immunoprecipitation: MCM2 Antibody (6A8) [H00004171-M01] - Analysis of MCM2 transfected lysate using anti-MCM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MCM2 MaxPab rabbit polyclonal ...read more
ELISA: MCM2 Antibody (6A8) [H00004171-M01] - Detection limit for recombinant GST tagged MCM2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
6A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MCM2 Antibody (6A8) Summary

Immunogen
MCM2 (AAH07670 805 a.a. - 904 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF
Specificity
MCM2 - MCM2 minichromosome maintenance deficient 2, mitotin (S. cerevisiae)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MCM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publications using
H00004171-M01 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MCM2 Antibody (6A8)

  • BM28
  • BM28MGC10606
  • CCNL 1
  • CCNL1
  • cdc19
  • CDCL1
  • CDCL1mitotin
  • D3S3194
  • EC 3.6.4.12
  • KIAA0030MITOTIN
  • MCM2 minichromosome maintenance deficient 2, mitotin (S. cerevisiae)
  • MCM2
  • minichromosome maintenance complex component 2
  • minichromosome maintenance deficient (S. cerevisiae) 2 (mitotin)
  • minichromosome maintenance deficient 2 (mitotin)
  • Mitotin

Background

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46403
Species: Hu
Applications: IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NB200-581
Species: Hu, Rt
Applications: WB, IP
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00004171-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for MCM2 Antibody (H00004171-M01)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for MCM2 Antibody (H00004171-M01) (0)

There are no reviews for MCM2 Antibody (H00004171-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MCM2 Antibody (H00004171-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCM2 Products

Bioinformatics Tool for MCM2 Antibody (H00004171-M01)

Discover related pathways, diseases and genes to MCM2 Antibody (H00004171-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM2 Antibody (H00004171-M01)

Discover more about diseases related to MCM2 Antibody (H00004171-M01).
 

Pathways for MCM2 Antibody (H00004171-M01)

View related products by pathway.

PTMs for MCM2 Antibody (H00004171-M01)

Learn more about PTMs related to MCM2 Antibody (H00004171-M01).
 

Research Areas for MCM2 Antibody (H00004171-M01)

Find related products by research area.

Blogs on MCM2

There are no specific blogs for MCM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM2 Antibody (6A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM2
Entrez
OMIM
Uniprot