Mcl-1 Antibody


Immunohistochemistry-Paraffin: Mcl-1 Antibody [NBP1-90006] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Mcl-1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
Specificity of human Mcl-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mcl-1 Recombinant Protein Antigen (NBP1-90006PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Mcl-1 Antibody

  • BCL2L3
  • bcl2-L-3
  • BCL2L3MGC104264
  • Bcl-2-like protein 3
  • Bcl-2-related protein EAT/mcl1
  • EAT
  • induced myeloid leukemia cell differentiation protein Mcl-1
  • Mcl1
  • Mcl-1
  • mcl1/EAT
  • MCL1-ES
  • MCL1L
  • MCL1S
  • MGC1839
  • myeloid cell leukemia ES
  • myeloid cell leukemia sequence 1 (BCL2-related)
  • TM


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for Mcl-1 Antibody (NBP1-90006) (0)

There are no publications for Mcl-1 Antibody (NBP1-90006).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mcl-1 Antibody (NBP1-90006) (0)

There are no reviews for Mcl-1 Antibody (NBP1-90006). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Mcl-1 Antibody (NBP1-90006) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Mcl-1 Products

Bioinformatics Tool for Mcl-1 Antibody (NBP1-90006)

Discover related pathways, diseases and genes to Mcl-1 Antibody (NBP1-90006). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mcl-1 Antibody (NBP1-90006)

Discover more about diseases related to Mcl-1 Antibody (NBP1-90006).

Pathways for Mcl-1 Antibody (NBP1-90006)

View related products by pathway.

PTMs for Mcl-1 Antibody (NBP1-90006)

Learn more about PTMs related to Mcl-1 Antibody (NBP1-90006).

Research Areas for Mcl-1 Antibody (NBP1-90006)

Find related products by research area.

Blogs on Mcl-1

There are no specific blogs for Mcl-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Mcl-1 Antibody and receive a gift card or discount.


Gene Symbol MCL1