MBP Antibody

Images

 
Western Blot: MBP Antibody [NBP2-56185] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: MBP Antibody [NBP2-56185] - Staining of human cell line HaCaT shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MBP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAP
Specificity
Specificity of human MBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MBP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MBP Antibody

  • Hmbpr
  • MBP
  • MGC99675
  • mld
  • Myelin A1 protein
  • myelin basic protein
  • Myelin membrane encephalitogenic protein
  • shi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP1-87781
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59322
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
6507-IL/CF
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56185
Species: Hu
Applications: WB, ICC/IF

Publications for MBP Antibody (NBP2-56185) (0)

There are no publications for MBP Antibody (NBP2-56185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBP Antibody (NBP2-56185) (0)

There are no reviews for MBP Antibody (NBP2-56185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MBP Antibody (NBP2-56185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MBP Products

Bioinformatics Tool for MBP Antibody (NBP2-56185)

Discover related pathways, diseases and genes to MBP Antibody (NBP2-56185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBP Antibody (NBP2-56185)

Discover more about diseases related to MBP Antibody (NBP2-56185).
 

Pathways for MBP Antibody (NBP2-56185)

View related products by pathway.

PTMs for MBP Antibody (NBP2-56185)

Learn more about PTMs related to MBP Antibody (NBP2-56185).
 

Research Areas for MBP Antibody (NBP2-56185)

Find related products by research area.

Blogs on MBP

There are no specific blogs for MBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MBP