MBP Antibody - BSA Free

Western Blot: MBP Antibody [NBP2-33555] - Analysis in mouse cerebral cortex tissue.

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse olfactory bulb shows immunoreactivity in processes in external plexiform layer.

Western Blot: MBP Antibody [NBP2-33555] - Analysis in human cerebral cortex tissue.

Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555] - Staining of human cerebral cortex shows positivity in oligodendrocytes.

Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555] - Staining of human hippocampus shows moderate immunoreactivity in myelinated fibers.

Immunohistochemistry-Paraffin: MBP Antibody [NBP2-33555] - Staining of human cerebellum shows moderate nuclear and cytoplasmic positivity in cells in granular layer.

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse cerebellum shows immunoreactivity in granular cell layer and in white matter.

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse cerebral cortex shows labeling of neuronal processes in motor cortex and in corpus callosum.

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse dorsal tenia tecta shows positivity in neuronal processes.

Immunohistochemistry: MBP Antibody [NBP2-33555] - Staining of mouse hippocampus shows positivity in neuronal processes in the CA1 layer.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MBP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MBP Antibody - BSA Free (NBP2-33555) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM
• Predicted Species: Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MBP Recombinant Protein Antigen (NBP2-33555PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MBP Antibody - BSA Free

• Hmbpr
• MBP
• MGC99675
• mld
• Myelin A1 protein
• myelin basic protein
• Myelin membrane encephalitogenic protein
• shi

Background

Myelin Basic Protein (MBP) functions in the nervous system in myelination and is expressed in oligodendrocytes following differentiation. There are numerous isoforms generated by differential splicing events and post-translational modifications that have specialized functions. These functions include participation in signaling pathways prior to myelination, myelination or the re-myelination process following neural injury.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MBP
• Uniprot:
  • P02686()