MBP-1 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
MBP-1 (AAH05929.1, 1 a.a. - 222 a.a.) full-length human protein. MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTQPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
PRG2 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for WB and Functional. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MBP-1 Antibody - Azide and BSA Free
Background
PRG2, also known as Bone marrow proteoglycan, is a 222 amino acid protein that is 25 kDa, found in high levels of the proform in placenta and pregnancy serum, may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions; is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases; and the proform acts as a proteinase inhibitor, reducing the activity of PAPPA. Disease research is currently being studied in relation to PRG2 and malignant peripheral nerve sheath tumor, epithelioid malignant peripheral nerve sheath tumor, ocular cicatricial pemphigoid, cicatricial pemphigoid, giant papillary conjunctivitis, vernal keratoconjunctivitis, corneal ulcer, allergic rhinitis, eosinophilic gastroenteritis, papillary conjunctivitis, hypereosinophilic syndrome, eosinophilia, pulmonary eosinophilia,connective tissue disease, kimura disease, rhinitis, retinal detachment, keratoconjunctivitis, eosinophilic esophagitis, and familial eosinophilia. The protein has been shown to interact with CHD3, PAPPA, PRKCZ, AGT, CSF2, and other proteins in MAPK Signaling, Molecular Mechanisms of Cancer, PTEN Pathway, Transendothelial Migration of Leukocytes, UPA-UPAR Pathway, Selected targets of C/EBPbeta and Asthma pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Rt
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: ELISA
Publications for MBP-1 Antibody (H00005553-B01P) (0)
There are no publications for MBP-1 Antibody (H00005553-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MBP-1 Antibody (H00005553-B01P) (0)
There are no reviews for MBP-1 Antibody (H00005553-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MBP-1 Antibody (H00005553-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MBP-1 Products
Research Areas for MBP-1 Antibody (H00005553-B01P)
Find related products by research area.
|
Blogs on MBP-1