MBL Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MBL Antibody - BSA Free (NBP1-85518) is a polyclonal antibody validated for use in IHC and WB. Anti-MBL Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MBL2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MBL Antibody - BSA Free
Background
Mannose-binding lectin, MBL, belongs to the C-type family of collectins. It functions as an opsonin which activates the alternative pathway of the complement system on binding to microbial polysaccharides.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Rt
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Publications for MBL Antibody (NBP1-85518)(2)
Showing Publications 1 -
2 of 2.
Reviews for MBL Antibody (NBP1-85518) (0)
There are no reviews for MBL Antibody (NBP1-85518).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MBL Antibody (NBP1-85518). (Showing 1 - 1 of 1 FAQs).
-
We are working with the innate immune system of the squid Euprymna scolopes, and we are interested in characterizing the presence and patter of expression of MBL. We know that your company manufactures an antibody against MBL and we were wondering if you think that it may be used to identify the protein in the squid. I am attaching the sequence of the gene that encodes MBL in the squid as a reference for you to compare. Thanks a lot for your help. Squid C-type lectin: QDPRRHSCYYFNNATYLLSDKNLDWKETSKYCRRFHGHLPTPRNKVQVEFLSSNINWSNFNGQRYWIGLVGPSWTWSDGSPLTFANWGHKQPSPKIPGVDTCAYVNVAQQHKWEDMTCTEKKNTGA
- I would not recommend using our product NBP1-85518 to detect your squid protein as the homology is very low.
Secondary Antibodies
| |
Isotype Controls
|
Additional MBL Products
Research Areas for MBL Antibody (NBP1-85518)
Find related products by research area.
|
Blogs on MBL