MAVS Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: MAVS Antibody [NBP2-38704] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704] - Staining of human liver shows moderate granular cytoplasmic positivity in bile duct cells and hepatocytes.
Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704] - Staining of human skin shows moderate granular cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MAVS Antibody [NBP2-38704] - Staining of human testis shows strong granular cytoplasmic positivity in leydig cells and sertoli cells.
Independent Antibodies: Staining of human gastrointestinal, liver, skin and testis using NBP2-38704 (A) shows similar protein distribution across tissues to independent antibody NBP2-38613 (B).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
 

Independent Antibodies

       

Order Details

View Available Formulations
Catalog# & Formulation Size Price

MAVS Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit MAVS Antibody - BSA Free (NBP2-38704) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAVS
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAVS Protein (NBP2-38704PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MAVS Antibody - BSA Free

  • CARD adapter inducing interferon beta
  • CARD adapter inducing interferon-beta
  • CARD adaptor inducing IFN-beta
  • Cardif
  • DKFZp547C224
  • DKFZp666M015
  • FLJ27482
  • IFN-B promoter stimulator 1
  • Interferon beta promoter stimulator protein 1
  • interferon-beta promoter stimulator protein 1
  • IPS-1
  • IPS-1FLJ41962
  • IPS1MGC3260
  • KIAA1271FLJ35386
  • MAVS
  • mitochondrial antiviral signaling protein
  • mitochondrial antiviral-signaling protein
  • mitochondrial viral signaling protein
  • Putative NF-kappa-B-activating protein 031N
  • virus-induced signaling adapter variant 1b
  • virus-induced signaling adaptor variant 1a
  • Virus-induced-signaling adapter
  • VISA
  • VISAFLJ38051

Background

Double-stranded RNA viruses are recognized in a cell type-dependent manner by the transmembrane receptor TLR3 (MIM 603029) or by the cytoplasmic RNA helicases MDA5 (MIM 606951) and RIGI (ROBO3; MIM 608630). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK; MIM 600664) and IKKB (IKBKB; MIM 603258), which activate NFKB (see MIM 164011), or TBK1 (MIM 604834) and IKKE (IKBKE; MIM 605048), which activate IRF3 (MIM 603734). Activated IRF3 and NFKB induce transcription of IFNB (IFNB1; MIM 147640). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1; MIM 607601). For RIGI, the intermediary protein is mitochondria-bound IPS1 (Sen and Sarkar, 2005).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC,  IHC-P, PEP-ELISA
8499-IF
Species: Hu
Applications: BA
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-85348
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-1207
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-56176
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67634
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo

Publications for MAVS Antibody (NBP2-38704) (0)

There are no publications for MAVS Antibody (NBP2-38704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAVS Antibody (NBP2-38704) (0)

There are no reviews for MAVS Antibody (NBP2-38704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAVS Antibody (NBP2-38704). (Showing 1 - 1 of 1 FAQ).

  1. Molecular weight of MAVS?
    • MAVS is a 540 aa protein with a predicted size of 56 kDa.

Secondary Antibodies

 

Isotype Controls

Additional MAVS Products

Research Areas for MAVS Antibody (NBP2-38704)

Find related products by research area.

Blogs on MAVS.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAVS Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MAVS
Uniprot