MAST205 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GESGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MAST2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MAST205 Antibody - BSA Free
Background
MAST2 (microtubule-associated serine/threonine-protein kinase 2) is also known as MAST205. MAST2 contains a well conserved protein kinase C/A kinase domain and a PDZ domain. It is highly expressed in spermatids and has been shown to play a role in cytokine responses in macrophages.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC
Publications for MAST205 Antibody (NBP1-87900) (0)
There are no publications for MAST205 Antibody (NBP1-87900).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAST205 Antibody (NBP1-87900) (0)
There are no reviews for MAST205 Antibody (NBP1-87900).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MAST205 Antibody (NBP1-87900) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MAST205 Products
Research Areas for MAST205 Antibody (NBP1-87900)
Find related products by research area.
|
Blogs on MAST205