MAST3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MAST3 Antibody [NBP1-82993] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MAST3 Antibody [NBP1-82993] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAST3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAST3 Antibody - BSA Free (NBP1-82993) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MAST3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVFILGEPDPPPAATPVMPKPSSLSADTAALSHARLRSNSIGARHSTPRPLDASRGRRLGGPRDPAPEKSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAST3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot Reported in scientific literature (PMID: 30449657)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MAST3 Protein (NBP1-82993PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30449657). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAST3 Antibody - BSA Free

• EC 2.7.11
• KIAA0561EC 2.7.11.1
• microtubule associated serine/threonine kinase 3
• microtubule-associated serine/threonine-protein kinase 3

Background

Microtubule associated serine/threonine kinase 3 or MAST3 is involved with protein phosphorylation. Belonging to the AGC Ser/Thr protein kinase family, MAST3 are cytoskeletal kinases associated with ATP binding, magnesium ion binding, protein binding and protein serine/threonine kinase activity. Popular protein domains for MAST3 include PDZ, protein kinase, AGC-kinase C-terminal domain and domain of unknown function (DUF1908). MAST3 is also known to interact with PTEN, PRKAB2, PRKAA2, CNTNAP4 and YWHAH.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAST3 Antibody (NBP1-82993)(2)

Publications using NBP1-82993

• Spinelli E, Christensen KR, Bryant E et al. Pathogenic MAST3 Variants in the STK Domain Are Associated with Epilepsy Annals of neurology 2021-08-01 [PMID: 34185323]
• Tripathy R, Leca I, van Dijk T et al. Mutations in MAST1 Cause Mega-Corpus-Callosum Syndrome with Cerebellar Hypoplasia and Cortical Malformations. Neuron. 2018-11-14 [PMID: 30449657] (WB, Mouse)

Bioinformatics

• Gene Symbol: MAST3