MAST3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAST3 Antibody [NBP1-82993] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MAST3 Antibody [NBP1-82993] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAST3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVFILGEPDPPPAATPVMPKPSSLSADTAALSHARLRSNSIGARHSTPRPLDASRGRRLGGPRDPAPEKSR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAST3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 30449657).
Control Peptide
MAST3 Protein (NBP1-82993PEP)
Publications
Read Publications using
NBP1-82993 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30449657). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAST3 Antibody

  • EC 2.7.11
  • KIAA0561EC 2.7.11.1
  • microtubule associated serine/threonine kinase 3
  • microtubule-associated serine/threonine-protein kinase 3

Background

Microtubule associated serine/threonine kinase 3 or MAST3 is involved with protein phosphorylation. Belonging to the AGC Ser/Thr protein kinase family, MAST3 are cytoskeletal kinases associated with ATP binding, magnesium ion binding, protein binding and protein serine/threonine kinase activity. Popular protein domains for MAST3 include PDZ, protein kinase, AGC-kinase C-terminal domain and domain of unknown function (DUF1908). MAST3 is also known to interact with PTEN, PRKAB2, PRKAA2, CNTNAP4 and YWHAH.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45756
Species: Hu, Mu, Rt
Applications: KO, WB
NBP1-83017
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-15910
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-17228
Species: Hu, Mu
Applications: WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-00955
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00009223-M03
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-13804
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-77533
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF4937
Species: Hu
Applications: IHC, WB
NBP1-30557
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-47559
Species: Hu
Applications: IHC, IHC-P, WB
H00150094-D01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
DM3A00
Species: Hu
Applications: ELISA
NBP2-46667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82993
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAST3 Antibody (NBP1-82993)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MAST3 Antibody (NBP1-82993) (0)

There are no reviews for MAST3 Antibody (NBP1-82993). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAST3 Antibody (NBP1-82993) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAST3 Products

Array NBP1-82993

Bioinformatics Tool for MAST3 Antibody (NBP1-82993)

Discover related pathways, diseases and genes to MAST3 Antibody (NBP1-82993). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAST3 Antibody (NBP1-82993)

Discover more about diseases related to MAST3 Antibody (NBP1-82993).
 

Pathways for MAST3 Antibody (NBP1-82993)

View related products by pathway.

PTMs for MAST3 Antibody (NBP1-82993)

Learn more about PTMs related to MAST3 Antibody (NBP1-82993).
 

Research Areas for MAST3 Antibody (NBP1-82993)

Find related products by research area.

Blogs on MAST3

There are no specific blogs for MAST3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAST3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAST3