Home » MAST3 » MAST3 Antibodies » MAST3 Antibody

MAST3 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: MAST3 Antibody [NBP1-82993] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: MAST3 Antibody [NBP1-82993] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MAST3 Antibody [NBP1-82993] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MAST3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVFILGEPDPPPAATPVMPKPSSLSADTAALSHARLRSNSIGARHSTPRPLDASRGRRLGGPRDPAPEKSR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAST3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 30449657).
Control Peptide
MAST3 Protein (NBP1-82993PEP)
Publications
Read Publications using
NBP1-82993 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30449657). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAST3 Antibody

  • EC 2.7.11
  • KIAA0561EC 2.7.11.1
  • microtubule associated serine/threonine kinase 3
  • microtubule-associated serine/threonine-protein kinase 3

Background

Microtubule associated serine/threonine kinase 3 or MAST3 is involved with protein phosphorylation. Belonging to the AGC Ser/Thr protein kinase family, MAST3 are cytoskeletal kinases associated with ATP binding, magnesium ion binding, protein binding and protein serine/threonine kinase activity. Popular protein domains for MAST3 include PDZ, protein kinase, AGC-kinase C-terminal domain and domain of unknown function (DUF1908). MAST3 is also known to interact with PTEN, PRKAB2, PRKAA2, CNTNAP4 and YWHAH.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAST205 Antibody
(OTI3A5)
NBP2-45756
Western Blot: MAST205 Antibody (OTI3A5) [NBP2-45756] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MAST2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MAST2.
Western Blot: MAST205 Antibody (OTI3A5) [NBP2-45756] - Equivalent amounts of cell lysates (10 ug per lane) of wild-type HeLa cells (WT) and MAST2-Knockout HeLa cells (KO) were separated by SDS-PAGE and immunoblotted with anti-MAST2 monoclonal antibody. Then the blotted membrane was stripped and reprobed with anti-HSP90 antibody as a loading control.
Species: Hu, Mu, Rt
Applications: KO, WB
MAST4 Antibody
NBP1-83017
Immunocytochemistry/Immunofluorescence: MAST4 Antibody [NBP1-83017] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: MAST4 Antibody [NBP1-83017] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAGI2 Antibody
AF7117
Western blot shows lysates of human brain (cortex) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for MAGI2 at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MAGI2 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to synaptic boutons and neuronal processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
MAGI2 was detected in immersion fixed U‑87 MG human glioblastoma/astrocytoma cell line using Goat Anti-Human MAGI2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7117) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
CLASP1 Antibody
NBP2-15910
Immunocytochemistry/Immunofluorescence: CLASP1 Antibody [NBP2-15910] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: CLASP1 Antibody [NBP2-15910] - Immunohistochemical analysis of paraffin-embedded 4T1 xenograft, using antibody at 1:100 dilution.
Western Blot: CLASP1 Antibody [NBP2-15910] - A: Hep G2.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DLG1 Antibody
NB600-1229
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of NIH-3T3 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of HeLa cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Western Blot: DLG1 Antibody [NB600-1229] - Analysis of 25 ug of C6 (lane 1), PC12 (lane 2) and rat brain (lane 3) cell lysates.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
MAST1 Antibody
NBP2-17228
Western Blot: MAST1 Antibody [NBP2-17228] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 5% SDS PAGE gel, diluted at 1:500.
Western Blot: MAST1 Antibody [NBP2-17228] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with MAST1 antibody [N2N3] diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
(3 Publications)
Species: Hu, Mu
Applications: WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Immunofluorescent staining of TMAs. Representative tissue cores from normal (I), adenomatous polyps (II), and CRC (III and IV) are shown. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
(5 Reviews)
(122 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - Analysis of Hela cells, using anti-Guanylate kinase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - Analysis of Jurkat cells, using anti-Guanylate kinase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Guanylate kinase antibody, and then analyzed by flow cytometry.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Tropomodulin 1
Antibody (OTI2C2)
NBP2-00955
Western Blot: Tropomodulin 1 Antibody (2C2) [NBP2-00955] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Tropomodulin 1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Tropomodulin 1.
Immunohistochemistry-Paraffin: Tropomodulin 1 Antibody (2C2) [NBP2-00955] - Staining of paraffin-embedded Human pancreas tissue using anti-Tropomodulin 1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Tropomodulin 1 Antibody (2C2) [NBP2-00955] - Staining of paraffin-embedded Human tonsil using anti-Tropomodulin 1 mouse monoclonal antibody.
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAGI1 Antibody
(7B4)
H00009223-M03
ELISA: MAGI1 Antibody (7B4) [H00009223-M03] - Detection limit for recombinant GST tagged MAGI1 is approximately 0.3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of monoclonal antibody to MAGI1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of MAGI1 expression in PC-12 (Cat # L012V1).
(3 Publications)
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
PPP6C Antibody
NBP2-13804
Western Blot: PPP6C Antibody [NBP2-13804] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human stomach shows moderate to strong granular cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
A20/TNFAIP3
Antibody (59A426) - B ...
NBP1-77533
Flow Cytometry: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - An intracellular stain was performed on SK-MEL-28 cells with A20/TNFAIP3 (59A426) antibody NBP1-77533AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-A20/TNFAIP3 (59A426) at 10 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective
Flow Cytometry: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - An intracellular stain was performed on RH-30 cells with A20/TNFAIP3 Antibody (59A426) NBP1-77533PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(42 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Reg1A/B Antibody
[Unconjugated]
AF4937
Reg1A was detected in immersion fixed paraffin-embedded sections of human pancreas using Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in exocrine cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pancreas tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Reg1A at approximately 20-22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IHC, WB
CACNA2D3 Antibody
- Azide and BSA Free
NBP1-30557
CACNA2D3 Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ACAD8 Antibody
NBP2-47559
Western Blot: ACAD8 Antibody [NBP2-47559] - Analysis in control (vector only transfected HEK293T lysate) and ACAD8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: IHC, IHC-P, WB
SIK1/Snf1lk
Antibody
H00150094-D01P
Immunocytochemistry/Immunofluorescence: SIK1/Snf1lk Antibody [H00150094-D01P] - Analysis of antibody to SIK1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: SIK1/Snf1lk Antibody [H00150094-D01P] - Analysis of SIK1 expression in human kidney.
Western Blot: SIK1/Snf1lk Antibody [H00150094-D01P] - Analysis of SIK1 expression in transfected 293T cell line by SIK1 polyclonal antibody.Lane 1: SNF1LK transfected lysate(84.90 KDa).Lane 2: Non-transfected lysate.
Species: Hu, Mu
Applications: ICC/IF, WB
CD19 Antibody
(CB19) - BSA Free
NBP2-25196
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Analysis using the FITC conjugate of NBP2-25196. Staining of CD19 in 10^6 human lymphocytes using 10 ul (0.25 ug) of this antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents anti-CD19 antibody.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Analysis using the PE conjugate of NBP2-25196. Staining of CD19 in 1x10^6 human PBMC using 10 ul (0.25 ug) of was used to test this product. Propidium iodide negative lymphocyte population gated for analysis.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Analysis using the Alexa Fluor (R) 700 conjugate of NBP2-25196. Staining of human PBMC. Image from verified customer review.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
CCL20/MIP-3 alpha
[HRP]
DM3A00
(50 Publications)
Species: Hu
Applications: ELISA
PPP2R2B Antibody
NBP2-46667
Immunohistochemistry-Paraffin: PPP2R2B Antibody [NBP2-46667] - Staining of human cerebral cortex shows distinct cytoplasmic and nuclear positivity in neuronal cells.
Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG, Lane 4: Human plasma, Lane 5: Human Liver tissue, Lane 6: Human Tonsil tissue.
Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAST3 Antibody
NBP1-82993
MAST3 Antibody
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAST3 Antibody (NBP1-82993)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MAST3 Antibody (NBP1-82993) (0)

There are no reviews for MAST3 Antibody (NBP1-82993). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAST3 Antibody (NBP1-82993) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAST3 Products

Array NBP1-82993

Bioinformatics Tool for MAST3 Antibody (NBP1-82993)

Discover related pathways, diseases and genes to MAST3 Antibody (NBP1-82993). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAST3 Antibody (NBP1-82993)

Discover more about diseases related to MAST3 Antibody (NBP1-82993).
 

Pathways for MAST3 Antibody (NBP1-82993)

View related products by pathway.

PTMs for MAST3 Antibody (NBP1-82993)

Learn more about PTMs related to MAST3 Antibody (NBP1-82993).
 

Research Areas for MAST3 Antibody (NBP1-82993)

Find related products by research area.

Blogs on MAST3

There are no specific blogs for MAST3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAST3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MAST3