MAST205 Antibody

Images

 
Immunohistochemistry: MAST205 Antibody [NBP1-87899] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAST205 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAST2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAST205 Protein (NBP1-87899PEP)
Publications
Read Publication using NBP1-87899.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23717670)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAST205 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ39200
  • KIAA0807RP4-533D7.1
  • MAST205microtubule associated testis specific serine/threonine protein kinase
  • microtubule associated serine/threonine kinase 2
  • microtubule-associated serine/threonine-protein kinase 2
  • MTSSK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17228
Species: Mu
Applications: WB
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-15910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-82993
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
AF4937
Species: Hu
Applications: WB, IHC
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
MAB7475
Species: Hu, Rt
Applications: WB
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NB100-41395
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
NBP1-87899
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MAST205 Antibody (NBP1-87899)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for MAST205 Antibody (NBP1-87899) (0)

There are no reviews for MAST205 Antibody (NBP1-87899). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAST205 Antibody (NBP1-87899) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAST205 Products

Bioinformatics Tool for MAST205 Antibody (NBP1-87899)

Discover related pathways, diseases and genes to MAST205 Antibody (NBP1-87899). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAST205 Antibody (NBP1-87899)

Discover more about diseases related to MAST205 Antibody (NBP1-87899).
 

Pathways for MAST205 Antibody (NBP1-87899)

View related products by pathway.

PTMs for MAST205 Antibody (NBP1-87899)

Learn more about PTMs related to MAST205 Antibody (NBP1-87899).
 

Research Areas for MAST205 Antibody (NBP1-87899)

Find related products by research area.

Blogs on MAST205

There are no specific blogs for MAST205, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAST205 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAST2