MAST205 Antibody - BSA Free

Immunohistochemistry-Paraffin: MAST205 Antibody [NBP1-87899] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAST205 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAST205 Antibody - BSA Free (NBP1-87899) is a polyclonal antibody validated for use in IHC and WB. Anti-MAST205 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQS
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAST2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 23717670). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MAST205 Protein (NBP1-87899PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23717670)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAST205 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• FLJ39200
• KIAA0807RP4-533D7.1
• MAST205microtubule associated testis specific serine/threonine protein kinase
• microtubule associated serine/threonine kinase 2
• microtubule-associated serine/threonine-protein kinase 2
• MTSSK

Background

MAST2 (microtubule-associated serine/threonine-protein kinase 2) is also known as MAST205. MAST2 contains a well conserved protein kinase C/A kinase domain and a PDZ domain. It is highly expressed in spermatids and has been shown to play a role in cytokine responses in macrophages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAST205 Antibody (NBP1-87899)(1)

Publication using NBP1-87899

• Eissmann M, Schwamb B, Melzer IM et al. A Functional Yeast Survival Screen of Tumor-Derived cDNA Libraries Designed to Identify Anti-Apoptotic Mammalian Oncogenes. PLoS One 2013-01-01 [PMID: 23717670] (WB)

Bioinformatics

• Gene Symbol: MAST2