MALT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MALT1 Antibody [NBP2-55513] - Staining of human cell line U-251 MG shows localization to nucleoli fibrillar center.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MALT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESF
Specificity
Specificity of human MALT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MALT1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MALT1 Recombinant Protein Antigen (NBP2-55513PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MALT1 Antibody

  • caspase-like protein
  • DKFZp434L132
  • EC 3.4.22.-
  • MALT associated translocation
  • MALT lymphoma-associated translocation
  • MALT1
  • MLT1
  • MLTMALT-lymphoma associated translocation
  • mucosa associated lymphoid tissue lymphoma translocation gene 1
  • mucosa-associated lymphoid tissue lymphoma translocation protein 1
  • Paracaspase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15554
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
AF4839
Species: Hu, Mu, Rt
Applications: WB
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56173
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-26506
Species: Hu, Mu, Rt
NBP2-15554
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NBP1-33042
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-98673
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for MALT1 Antibody (NBP2-55513) (0)

There are no publications for MALT1 Antibody (NBP2-55513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MALT1 Antibody (NBP2-55513) (0)

There are no reviews for MALT1 Antibody (NBP2-55513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MALT1 Antibody (NBP2-55513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MALT1 Products

Bioinformatics Tool for MALT1 Antibody (NBP2-55513)

Discover related pathways, diseases and genes to MALT1 Antibody (NBP2-55513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MALT1 Antibody (NBP2-55513)

Discover more about diseases related to MALT1 Antibody (NBP2-55513).
 

Pathways for MALT1 Antibody (NBP2-55513)

View related products by pathway.

PTMs for MALT1 Antibody (NBP2-55513)

Learn more about PTMs related to MALT1 Antibody (NBP2-55513).
 

Research Areas for MALT1 Antibody (NBP2-55513)

Find related products by research area.

Blogs on MALT1

There are no specific blogs for MALT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MALT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MALT1