MALT1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MALT1 Antibody - BSA Free (NBP2-55513) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESF |
| Predicted Species |
Mouse (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MALT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MALT1 Antibody - BSA Free
Background
Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (MALT1), also known as MLT1 or paracaspase 1, is a member of the human paracaspase family and an interacting partner of B-cell lymphoma 10 (Bcl-10) (1). In vitro, In vitro, MALT1 synergizes with BCL10 to enhance nuclear factor B activation (2) and to mediate IB kinase (IKK) activation by facilitating the ubiquitinylation of the NF-B essential modulator (NEMO) (3). MALT1 is found in recurrent chromosomal translocations in non-Hodgkin B-cell lymphoma of the mucosa-associated lymphoid tissue (MALT). One common translocation juxtaposes the MALT1 gene to the IgH promoter region, resulting in up-regulation of Bcl-10 and MALT1 (4). Another common translocation creates a fusion between MALT1 and the inhibitor of apoptosis gene API2 (cIAP2/HIAP1) (5).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Publications for MALT1 Antibody (NBP2-55513) (0)
There are no publications for MALT1 Antibody (NBP2-55513).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MALT1 Antibody (NBP2-55513) (0)
There are no reviews for MALT1 Antibody (NBP2-55513).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MALT1 Antibody (NBP2-55513) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MALT1 Products
Research Areas for MALT1 Antibody (NBP2-55513)
Find related products by research area.
|
Blogs on MALT1