MAK16 Antibody - Azide and BSA Free

Western Blot: MAK16 Antibody [NBP3-15975] - Western blot analysis of extracts of various cell lines, using MAK16 antibody (NBP3-15975) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Western Blot: MAK16 Antibody [NBP3-15975] - Western blot analysis of extracts of Rat testis, using MAK16 antibody (NBP3-15975) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAK16 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MAK16 Antibody - Azide and BSA Free (NBP3-15975) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-120 of human MAK16 (NP_115898.2). RNEYSLTGLCNRSSCPLANSQYATIKEEKGQCYLYMKVIERAAFPRRLWERVRLSKNYEKALEQIDENLIYWPRFIRHKCKQRFTKITQYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAK16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MAK16 Antibody - Azide and BSA Free

• MAK16 homolog (S. cerevisiae)
• MAK16L
• NNP78
• protein MAK16 homolog
• Protein RBM13
• RBM13
• RNA binding motif protein 13
• RNA binding protein

Background

RBM13 (RNA-binding motif protein 13) is a member of the MAK16 (maintenance of killer protein 16) family of proteins. Despite its name, RBM13 has not been shown to be an RNA-binding protein, and the function of RBM13 is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MAK16