WDR61 Antibody

Images

 
Western Blot: WDR61 Antibody [NBP1-80844] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: WDR61 Antibody [NBP1-80844] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human testis shows strong nuclear and cytoplasmic positivity in subsets of cells in seminiferus ducts.
Western Blot: WDR61 Antibody [NBP1-80844] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR61 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTR
Specificity
Specificity of human, mouse, rat WDR61 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR61
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WDR61 Protein (NBP1-80844PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR61 Antibody

  • Meiotic recombination REC14 protein homolog
  • REC14
  • recombination protein REC14
  • SKI8
  • WD repeat domain 61
  • WD repeat-containing protein 61

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58172
Species: Hu
Applications: WB
NBP1-77305
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
NBP1-82170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NB500-191
Species: Hu, Mu
Applications: WB, IP
29470002
Species: Ce
Applications: ELISA, ICC/IF, IHC
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-57648
Species: Hu
Applications: WB, ICC/IF
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NBP2-14089
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-273
Species: Hu, Mu
Applications: WB, IP
H00010518-A01
Species: Hu, Ze
Applications: WB, ChIP, ELISA
6144-GH
Species: Hu
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P

Publications for WDR61 Antibody (NBP1-80844) (0)

There are no publications for WDR61 Antibody (NBP1-80844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR61 Antibody (NBP1-80844) (0)

There are no reviews for WDR61 Antibody (NBP1-80844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WDR61 Antibody (NBP1-80844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for WDR61 Antibody (NBP1-80844)

Discover related pathways, diseases and genes to WDR61 Antibody (NBP1-80844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WDR61

There are no specific blogs for WDR61, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR61 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR61