FAM60A Antibody

Images

 
Western Blot: FAM60A Antibody [H00058516-B02P] - Analysis of FAM60A expression in transfected 293T cell line by FAM60A polyclonal antibody. Lane 1: FAM60A transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: FAM60A Antibody [H00058516-B02P] - Analysis of purified antibody to FAM60A on HeLa cell. (antibody concentration 30 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FAM60A Antibody Summary

Immunogen
FAM60A (NP_067061.1, 1 a.a. - 221 a.a.) full-length human protein. MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SINHCAF
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
Application Notes
Immunohistochemistry and knockdown validation (PMID: 31727367).
Publications
Read Publication using
H00058516-B02P in the following applications:

  • IHC
    1 publication
  • 1 publication
  • KD
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FAM60A Antibody

  • C12orf14
  • chromosome 12 open reading frame 14
  • family with sequence similarity 60, member A
  • Tera protein homolog
  • TERA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-06069
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
CD6
627-CD
Species: Hu
NBP3-05567
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for FAM60A Antibody (H00058516-B02P)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 4 applications: IHC, IHC-P, KD, WB.


Filter By Application
IHC
(1)
IHC-P
(1)
KD
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FAM60A Antibody (H00058516-B02P) (0)

There are no reviews for FAM60A Antibody (H00058516-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM60A Antibody (H00058516-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM60A Products

Bioinformatics Tool for FAM60A Antibody (H00058516-B02P)

Discover related pathways, diseases and genes to FAM60A Antibody (H00058516-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FAM60A Antibody (H00058516-B02P)

View related products by pathway.

PTMs for FAM60A Antibody (H00058516-B02P)

Learn more about PTMs related to FAM60A Antibody (H00058516-B02P).
 

Research Areas for FAM60A Antibody (H00058516-B02P)

Find related products by research area.

Blogs on FAM60A

There are no specific blogs for FAM60A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM60A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SINHCAF
Uniprot