| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, Mycoplasma |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse FAM60A Antibody - Azide and BSA Free (H00058516-B02P) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-FAM60A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | FAM60A (NP_067061.1, 1 a.a. - 221 a.a.) full-length human protein. MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SINHCAF |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Immunohistochemistry and knockdown validation (PMID: 31727367). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
| Publication using H00058516-B02P | Applications | Species |
|---|---|---|
| Yao X, Liu D, Zhou L et al. FAM60A, increased by Helicobacter pylori, promotes proliferation and suppresses apoptosis of gastric cancer cells by targeting the PI3K/AKT pathway Biochem. Biophys. Res. Commun. 2019-11-11 [PMID: 31727367] (WB, IF/IHC, IHC-P, KD, Human) | WB, IF/IHC, IHC-P, KD | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for FAM60A Antibody (H00058516-B02P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SINHCAF |
| Uniprot |
|