ALPK3 Antibody (4G4)

Images

 
Immunocytochemistry/ Immunofluorescence: ALPK3 Antibody (4G4) [H00057538-M01] - Analysis of monoclonal antibody to ALPK3 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ALPK3 Antibody (4G4) [H00057538-M01] - Analysis of monoclonal antibody to ALPK3 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ALPK3 Antibody (4G4) Summary

Immunogen
ALPK3 (NP_065829, 1811 a.a. ~ 1906 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQKKGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGM
Localization
Nucleus
Specificity
ALPK3 - alpha-kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALPK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALPK3 Antibody (4G4)

  • alpha-kinase 3
  • EC 2.7.11.-
  • FLJ12881
  • FLJ21176
  • KIAA1330MIDORI
  • MAKalpha-protein kinase 3
  • Midori
  • muscle alpha-kinase
  • Muscle alpha-protein kinase
  • myocyte induction differentiation originator

Background

Kinases that recognize phosphorylation sites in which the surrounding peptides have an alpha-helical conformation. Plays a role in cardiomyocyte differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ALPK3 Antibody (H00057538-M01) (0)

There are no publications for ALPK3 Antibody (H00057538-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALPK3 Antibody (H00057538-M01) (0)

There are no reviews for ALPK3 Antibody (H00057538-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALPK3 Antibody (H00057538-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALPK3 Products

Array H00057538-M01

Research Areas for ALPK3 Antibody (H00057538-M01)

Find related products by research area.

Blogs on ALPK3

There are no specific blogs for ALPK3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALPK3 Antibody (4G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALPK3
Entrez
Uniprot