MAGP-1/MFAP2 Antibody

Images

 
Immunohistochemistry-Paraffin: MAGP-1/MFAP2 Antibody [NBP1-87735] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: MAGP-1/MFAP2 Antibody [NBP1-87735] - Staining of human gallbladder shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MAGP-1/MFAP2 Antibody [NBP1-87735] - Staining in human gallbladder and kidney tissues using anti-MFAP2 antibody. Corresponding MFAP2 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MAGP-1/MFAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCG
Specificity
Specificity of human MAGP-1/MFAP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MFAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAGP-1/MFAP2 Protein (NBP1-87735PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAGP-1/MFAP2 Antibody

  • MAGP1
  • MAGP-1
  • MAGP-1FLJ50901
  • MAGPMFAP-2
  • MFAP2
  • Microfibril-associated glycoprotein 1
  • microfibrillar-associated protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NB110-8146
Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP1-82803
Species: Hu
Applications: IHC, IHC-P
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85432
Species: Hu
Applications: IHC, IHC-P
NBP2-67511
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3850
Species: Hu
Applications: WB
MAB3095
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
6449-TEC/CF
Species: Hu
NB400-146
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
AF3158
Species: Mu
Applications: WB, ChIP, ICC
MAB3446
Species: Hu
Applications: WB
MAB388
Species: Hu
Applications: WB, AP
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87735
Species: Hu
Applications: IHC, IHC-P

Publications for MAGP-1/MFAP2 Antibody (NBP1-87735) (0)

There are no publications for MAGP-1/MFAP2 Antibody (NBP1-87735).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGP-1/MFAP2 Antibody (NBP1-87735) (0)

There are no reviews for MAGP-1/MFAP2 Antibody (NBP1-87735). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAGP-1/MFAP2 Antibody (NBP1-87735) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MAGP-1/MFAP2 Antibody (NBP1-87735)

Discover related pathways, diseases and genes to MAGP-1/MFAP2 Antibody (NBP1-87735). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGP-1/MFAP2 Antibody (NBP1-87735)

Discover more about diseases related to MAGP-1/MFAP2 Antibody (NBP1-87735).
 

Pathways for MAGP-1/MFAP2 Antibody (NBP1-87735)

View related products by pathway.

Blogs on MAGP-1/MFAP2

There are no specific blogs for MAGP-1/MFAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGP-1/MFAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFAP2
Entrez
Uniprot