MAGP-2/MFAP5 Antibody - BSA Free

Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining in human smooth muscle and cerebral cortex tissues using anti-MFAP5 antibody. Corresponding MFAP5 RNA-seq data are presented for the same tissues.

Western Blot: MAGP-2/MFAP5 Antibody [NBP1-82803] - Analysis in human cell line BEWO.

Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human smooth muscle shows high expression.

Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human rectum shows strong membranous positivity in cells in lamina propria.

Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human testis shows strong membranous positivity in cells in lamina propria.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAGP-2/MFAP5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAGP-2/MFAP5 Antibody - BSA Free (NBP1-82803) is a polyclonal antibody validated for use in IHC and WB. Anti-MAGP-2/MFAP5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MFAP5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MAGP-2/MFAP5 Protein (NBP1-82803PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAGP-2/MFAP5 Antibody - BSA Free

• MAGP2
• MAGP-2
• MAGP2MFAP-5
• MFAP5
• Microfibril-associated glycoprotein 2
• microfibrillar associated protein 5
• microfibrillar-associated protein 5
• MP25
• MP25microfibril-associated glycoprotein-2

Background

MFAP5, also known as Microfibrillar-associated protein 5, is a 173 amino acid protein that is 20 kDa, extracellular matrix secreted, and it is a component of the elastin-associated microfibrils. Current research is being performed on this protein involvement in marfan syndrome, scleroderma and skin fibrosis. The protein is involved in molecules associated with elastic fibres, extracellular matrix organization, elastic fibre formation, tropoelastin associates with microfibrils, elastin cross-linking by lysyl oxidase, and notch signaling pathways where it interacts with FBN2, JAG1, JAG2, MEGF6, VWF, FBLN1, FBN1, GYG1, DLL1, MFAP2, NOTCH1, ENAM, FBN3, and DLL4 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAGP-2/MFAP5 Antibody (NBP1-82803)(1)

Publication using NBP1-82803

• Leung CS, Yeung TL, Yip KP et al. Calcium Dependent FAK/CREB/TNNC1 Signaling Mediates the Effect of Stromal MFAP5 on Ovarian Cancer Metastatic Potential. Nat Commun 2014-10-03 [PMID: 25277212] (IF/IHC, WB, Human)

Bioinformatics

• Gene Symbol: MFAP5