MAGEA11 Antibody


Western Blot: MAGEA11 Antibody [NBP1-69034] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MAGEA11 Antibody Summary

Synthetic peptides corresponding to MAGEA11 (melanoma antigen family A, 11) The peptide sequence was selected from the middle region of MAGEA11. Peptide sequence FSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MAGEA11 and was validated on Western blot.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAGEA11 Antibody

  • Cancer/testis antigen 1.11
  • CT1.11MAGE-11 antigen
  • MAGE11member 11
  • MAGEA-11
  • melanoma antigen family A, 11
  • melanoma-associated antigen 11
  • MGC10511


This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: IP (-), WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr

Publications for MAGEA11 Antibody (NBP1-69034) (0)

There are no publications for MAGEA11 Antibody (NBP1-69034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEA11 Antibody (NBP1-69034) (0)

There are no reviews for MAGEA11 Antibody (NBP1-69034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEA11 Antibody (NBP1-69034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MAGEA11 Products

Bioinformatics Tool for MAGEA11 Antibody (NBP1-69034)

Discover related pathways, diseases and genes to MAGEA11 Antibody (NBP1-69034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEA11 Antibody (NBP1-69034)

Discover more about diseases related to MAGEA11 Antibody (NBP1-69034).

Pathways for MAGEA11 Antibody (NBP1-69034)

View related products by pathway.

PTMs for MAGEA11 Antibody (NBP1-69034)

Learn more about PTMs related to MAGEA11 Antibody (NBP1-69034).

Blogs on MAGEA11

There are no specific blogs for MAGEA11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MAGEA11 Antibody and receive a gift card or discount.


Gene Symbol MAGEA11