MAG/Siglec-4a Antibody (3C7) - Azide and BSA Free

Western Blot: MAG/Siglec-4a Antibody (3C7) [H00004099-M35] - Analysis of MAG expression in Jurkat (Cat # L017V1).

Immunohistochemistry-Paraffin: MAG/Siglec-4a Antibody (3C7) [H00004099-M35] - Analysis of monoclonal antibody to MAG on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml

Sandwich ELISA: MAG/Siglec-4a Antibody (3C7) [H00004099-M35] - Detection limit for recombinant GST tagged MAG is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 3C7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAG/Siglec-4a Antibody (3C7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MAG (NP_002352, 119 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR
• Specificity: MAG - myelin associated glycoprotein (3C7)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MAG
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAG/Siglec-4a Antibody (3C7) - Azide and BSA Free

• GMAsialic acid binding Ig-like lectin 4A
• MAG
• myelin associated glycoprotein
• myelin-associated glycoprotein
• sialic acid-binding immunoglobulin-like lectin 4A
• Siglec4a
• Siglec-4a
• S-MAG

Background

The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Two alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAG
• Entrez:
  • 4099(Human)
• Uniprot:
  • NP_002352()