M-Cadherin/Cadherin-15 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: M-Cadherin/Cadherin-15 Antibody [NBP1-88101] - Immunofluorescent staining of human cell line RH-30 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: M-Cadherin/Cadherin-15 Antibody [NBP1-88101] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

M-Cadherin/Cadherin-15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYRAIVLAQDDASQPRTATGTLSIEILEVNDHAPVLAPPPPGSLCSEPHQGPGLLLGATDEDLPPHGAPFHFQLSPRLPELGRNWSLSQVNVSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDH15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
M-Cadherin/Cadherin-15 Protein (NBP1-88101PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for M-Cadherin/Cadherin-15 Antibody

  • cadherin 15, M-cadherin (myotubule)
  • cadherin 15, type 1, M-cadherin (myotubule)
  • Cadherin-14
  • Cadherin-15
  • cadherin-3
  • CDH14
  • CDH14cadherin-14
  • CDH15
  • CDH3cadherin-15
  • CDHM
  • MCAD
  • MCadherin
  • M-Cadherin
  • MRD3
  • Muscle cadherin
  • muscle-cadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03047
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000034-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-33588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for M-Cadherin/Cadherin-15 Antibody (NBP1-88101) (0)

There are no publications for M-Cadherin/Cadherin-15 Antibody (NBP1-88101).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for M-Cadherin/Cadherin-15 Antibody (NBP1-88101) (0)

There are no reviews for M-Cadherin/Cadherin-15 Antibody (NBP1-88101). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for M-Cadherin/Cadherin-15 Antibody (NBP1-88101) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional M-Cadherin/Cadherin-15 Products

Bioinformatics Tool for M-Cadherin/Cadherin-15 Antibody (NBP1-88101)

Discover related pathways, diseases and genes to M-Cadherin/Cadherin-15 Antibody (NBP1-88101). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for M-Cadherin/Cadherin-15 Antibody (NBP1-88101)

Discover more about diseases related to M-Cadherin/Cadherin-15 Antibody (NBP1-88101).
 

Pathways for M-Cadherin/Cadherin-15 Antibody (NBP1-88101)

View related products by pathway.

PTMs for M-Cadherin/Cadherin-15 Antibody (NBP1-88101)

Learn more about PTMs related to M-Cadherin/Cadherin-15 Antibody (NBP1-88101).

Blogs on M-Cadherin/Cadherin-15

There are no specific blogs for M-Cadherin/Cadherin-15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our M-Cadherin/Cadherin-15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH15
Entrez