Caldesmon/CALD1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Caldesmon/CALD1 Antibody [NBP1-85702] - Staining of human cell line U-2 OS shows localization to plasma membrane and actin filaments. Antibody staining is shown in green.

Staining of human testis shows strong cytoplasmic positivity in peritubular myoid cells.

Staining of human duodenum shows strong cytoplasmic positivity in smooth muscle cells.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Staining of human fallopian tube shows strong cytoplasmic positivity in smooth muscle cells and blood vessles.

Staining of human fallopian tube, gastrointestinal, prostate and testis using Anti-CALD1 antibody NBP1-85702 (A) shows similar protein distribution across tissues to independent antibody NBP1-85701 (B).

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Analysis in human prostate and skeletal muscle tissues using HPA008066 antibody. Corresponding CALD1 RNA-seq data are presented for the same tissues.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell lines U-251MG and MCF-7 using Anti-CALD1 antibody. Corresponding CALD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Caldesmon/CALD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Caldesmon/CALD1 Antibody - BSA Free (NBP1-85702) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Caldesmon/CALD1 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Caldesmon/CALD1 Protein (NBP1-85702PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Caldesmon/CALD1 Antibody - BSA Free

• CAD
• CALD1
• caldesmon 1
• Caldesmon
• CDM
• CDMH-CAD
• HCAD
• LCAD
• L-CAD
• MGC21352
• NAG22

Background

Caldesmon is a smooth muscle and nonmuscle regulatory protein that interacts with actin, myosin, tropomyosin, and calmodulin (1,2). Smooth muscle caldesmon is an elongated molecule with a calmodulin, tropomyosin, and actin-binding region at the C-terminus and a myosin-binding domain at the N-terminus (3). Caldesmon stimulates actin binding of tropomyosin which increases the stabilization of actin filament structure. In muscle tissues, caldesmon inhibits the actomyosin ATPase by binding to F-actin. This inhibition is reduced by calcium-calmodulin and is promoted by tropomyosin (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Caldesmon/CALD1 Antibody (NBP1-85702)(4)

Publications using NBP1-85702

• Alexandre Calon, Enza Lonardo, Antonio Berenguer-Llergo et al. Stromal gene expression defines poor-prognosis subtypes in colorectal cancer. Nature Genetics 2015-02-23 [PMID: 25706628] (IF/IHC, Human)
• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]
• Fagerberg L, Stadler C, Skogs M et al. Mapping the subcellular protein distribution in three human cell lines. J Proteome Res 2011-08-01 [PMID: 21675716]
• Kohler CN, et al. Histochemical localization of caldesmon in the CNS and ganglia of the mouse. J Histochem Cytochem 2011-05-01 [PMID: 21411712]

Bioinformatics

• Gene Symbol: CALD1