Caldesmon/CALD1 Antibody

Images

 
Independent Antibodies: Western Blot: Caldesmon/CALD1 Antibody [NBP1-85702] - Analysis using Anti-CALD1 antibody NBP1-85702 (A) shows similar pattern to independent antibody NBP1-85701 (B).
Immunocytochemistry/ Immunofluorescence: Caldesmon/CALD1 Antibody [NBP1-85702] - Staining of human cell line U-2 OS shows localization to plasma membrane and actin filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Caldesmon/CALD1 Antibody [NBP1-85702] - Staining of human cerebral cortex.
Western Blot: Caldesmon/CALD1 Antibody [NBP1-85702] - Analysis in human cell line U-138 MG.
Western Blot: Caldesmon/CALD1 Antibody [NBP1-85702] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Orthogonal Strategies: Western Blot: Caldesmon/CALD1 Antibody [NBP1-85702] - Analysis in human cell lines U-251MG and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: Caldesmon/CALD1 Antibody [NBP1-85702] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Caldesmon/CALD1 Antibody [NBP1-85702] - Staining of human smooth muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Caldesmon/CALD1 Antibody [NBP1-85702] - Staining in human smooth muscle and skeletal muscle tissues using anti-CALD1 antibody. Corresponding CALD1 RNA-seq ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Caldesmon/CALD1 Antibody [NBP1-85702] - Staining of human cerebral cortex, placenta, skeletal muscle and smooth muscle using Anti-CALD1 antibody NBP1-85702 ...read more
Immunohistochemistry-Paraffin: Caldesmon/CALD1 Antibody [NBP1-85702] - Staining of human placenta.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Caldesmon/CALD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTS
Specificity
Specificity of human, mouse, rat Caldesmon/CALD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC reported in scientific literature (PMID: 25706628). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
Caldesmon/CALD1 Knockout HeLa Cell Lysate
Control Peptide
Publications
Read Publications using
NBP1-85702 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25706628).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Caldesmon/CALD1 Antibody

  • CAD
  • CALD1
  • caldesmon 1
  • Caldesmon
  • CDM
  • CDMH-CAD
  • HCAD
  • LCAD
  • L-CAD
  • MGC21352
  • NAG22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu, Rt, Po
Applications: WB
MAB4470
Species: Multi
Applications: WB, IHC, ICC
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-62682
Species: Hu
Applications: IHC, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00085366-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Caldesmon/CALD1 Antibody (NBP1-85702)(4)

Reviews for Caldesmon/CALD1 Antibody (NBP1-85702) (0)

There are no reviews for Caldesmon/CALD1 Antibody (NBP1-85702). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Caldesmon/CALD1 Antibody (NBP1-85702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Caldesmon/CALD1 Products

Bioinformatics Tool for Caldesmon/CALD1 Antibody (NBP1-85702)

Discover related pathways, diseases and genes to Caldesmon/CALD1 Antibody (NBP1-85702). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caldesmon/CALD1 Antibody (NBP1-85702)

Discover more about diseases related to Caldesmon/CALD1 Antibody (NBP1-85702).
 

Pathways for Caldesmon/CALD1 Antibody (NBP1-85702)

View related products by pathway.

PTMs for Caldesmon/CALD1 Antibody (NBP1-85702)

Learn more about PTMs related to Caldesmon/CALD1 Antibody (NBP1-85702).
 

Research Areas for Caldesmon/CALD1 Antibody (NBP1-85702)

Find related products by research area.

Blogs on Caldesmon/CALD1

There are no specific blogs for Caldesmon/CALD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Caldesmon/CALD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALD1