ACADL Antibody

Images

 
Western Blot: ACADL Antibody [NBP1-89289] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human thyroid gland shows strong cytoplasmic positivity with a granular pattern in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Analysis in human thyroid gland and cerebral cortex tissues. Corresponding ACADL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human lung shows moderate to strong granular cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human cerebral cortex shows no positivity as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ACADL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GEERLETPSAKKLTDIGIRRIFSPEHDIFRKSVRKFFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLGVNIAEHLGGIGGDLYSAAIVWEEQAYSNCSGPGFSIHSGIVMSYITNHGSEEQIKHFIPQMT
Specificity
Specificity of human, mouse, rat ACADL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACADL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACADL Protein (NBP1-89289PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACADL Antibody

  • ACAD4
  • acyl-CoA dehydrogenase, long chain
  • acyl-Coenzyme A dehydrogenase, long chain
  • EC 1.3.99
  • EC 1.3.99.13
  • LCADFLJ94052
  • long-chain specific acyl-CoA dehydrogenase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000037-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-53791
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67699
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NB100-59742
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, PEP-ELISA
NB110-41487
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF
NBP2-71055
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-19860
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-89114
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACADL Antibody (NBP1-89289) (0)

There are no publications for ACADL Antibody (NBP1-89289).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACADL Antibody (NBP1-89289) (0)

There are no reviews for ACADL Antibody (NBP1-89289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACADL Antibody (NBP1-89289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACADL Products

Array NBP1-89289

Bioinformatics Tool for ACADL Antibody (NBP1-89289)

Discover related pathways, diseases and genes to ACADL Antibody (NBP1-89289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACADL Antibody (NBP1-89289)

Discover more about diseases related to ACADL Antibody (NBP1-89289).
 

Pathways for ACADL Antibody (NBP1-89289)

View related products by pathway.

PTMs for ACADL Antibody (NBP1-89289)

Learn more about PTMs related to ACADL Antibody (NBP1-89289).

Blogs on ACADL

There are no specific blogs for ACADL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACADL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACADL