HADHA Antibody

Images

 
Western Blot: HADHA Antibody [NBP1-83387] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: HADHA Antibody [NBP1-83387] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: HADHA Antibody [NBP1-83387] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Western Blot: HADHA Antibody [NBP1-83387] - Analysis in human cell line HepG2.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HADHA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HADHA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HADHA Protein (NBP1-83387PEP)
Publications
Read Publication using NBP1-83387.

Reactivity Notes

Rat (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HADHA Antibody

  • 3-ketoacyl-Coenzyme A (CoA) thiolase, alpha subunit
  • 3-oxoacyl-CoA thiolase
  • 78 kDa gastrin-binding protein
  • ECHA
  • gastrin-binding protein
  • GBP
  • HADH
  • hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), alpha subunit
  • hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit
  • LCEH
  • LCHAD
  • long-chain 2-enoyl-CoA hydratase
  • long-chain-3-hydroxyacyl-CoA dehydrogenase
  • MGC1728
  • mitochondrial long-chain 2-enoyl-Coenzyme A (CoA) hydratase, alpha subunit
  • mitochondrial long-chain L-3-hydroxyacyl-Coenzyme A (CoA) dehydrogenase, alphasubunit
  • mitochondrial trifunctional enzyme, alpha subunit
  • mitochondrial trifunctional protein, alpha subunit
  • MTPATP-ALPHA
  • TP-alpha
  • trifunctional enzyme subunit alpha, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
AF4715
Species: Mu
Applications: WB
NBP2-03972
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-82609
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-20183
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for HADHA Antibody (NBP1-83387)(1)

Reviews for HADHA Antibody (NBP1-83387) (0)

There are no reviews for HADHA Antibody (NBP1-83387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HADHA Antibody (NBP1-83387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HADHA Products

Bioinformatics Tool for HADHA Antibody (NBP1-83387)

Discover related pathways, diseases and genes to HADHA Antibody (NBP1-83387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HADHA Antibody (NBP1-83387)

Discover more about diseases related to HADHA Antibody (NBP1-83387).
 

Pathways for HADHA Antibody (NBP1-83387)

View related products by pathway.

PTMs for HADHA Antibody (NBP1-83387)

Learn more about PTMs related to HADHA Antibody (NBP1-83387).

Blogs on HADHA

There are no specific blogs for HADHA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HADHA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HADHA