Home » HADHA » HADHA Antibodies » HADHA Antibody

HADHA Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: HADHA Antibody [NBP1-83387] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-HADHA antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Genetic Strategies: Western Blot: HADHA Antibody [NBP1-83387] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-HADHA antibody. Remaining relative intensity is ...read more
Immunocytochemistry/ Immunofluorescence: HADHA Antibody [NBP1-83387] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HADHA Antibody [NBP1-83387] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: HADHA Antibody [NBP1-83387] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: HADHA Antibody [NBP1-83387] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: HADHA Antibody [NBP1-83387] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: HADHA Antibody [NBP1-83387] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

HADHA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDK
Specificity
Specificity of human, mouse HADHA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HADHA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
HADHA Knockout 293T Cell Lysate
Control Peptide
Publications
Read Publication using NBP1-83387.

Reactivity Notes

Rat (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HADHA Antibody

  • 3-ketoacyl-Coenzyme A (CoA) thiolase, alpha subunit
  • 3-oxoacyl-CoA thiolase
  • 78 kDa gastrin-binding protein
  • ECHA
  • gastrin-binding protein
  • GBP
  • HADH
  • hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), alpha subunit
  • hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit
  • LCEH
  • LCHAD
  • long-chain 2-enoyl-CoA hydratase
  • long-chain-3-hydroxyacyl-CoA dehydrogenase
  • MGC1728
  • mitochondrial long-chain 2-enoyl-Coenzyme A (CoA) hydratase, alpha subunit
  • mitochondrial long-chain L-3-hydroxyacyl-Coenzyme A (CoA) dehydrogenase, alphasubunit
  • mitochondrial trifunctional enzyme, alpha subunit
  • mitochondrial trifunctional protein, alpha subunit
  • MTPATP-ALPHA
  • TP-alpha
  • trifunctional enzyme subunit alpha, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma.
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(13 Reviews)
(325 Publications)
Species: Hu
Sterol carrier
protein 2 Antibody
NBP1-85958
Western Blot: Sterol carrier protein 2 Antibody [NBP1-85958] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Sterol carrier protein 2 Antibody [NBP1-85958] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: Sterol carrier protein 2 Antibody [NBP1-85958] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ERAB Antibody
(OTI10B4)
NBP2-02118
Western Blot: ERAB Antibody (10B4) [NBP2-02118] Analysis of extracts (35ug) from 9 different cell lines by using anti-ERAB monoclonal antibody.
Immunocytochemistry/Immunofluorescence: ERAB Antibody (10B4) [NBP2-02118] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY ERAB.
Immunohistochemistry-Paraffin: ERAB Antibody (10B4) [NBP2-02118] - Staining of paraffin-embedded pancreas tissue using anti-ERABmouse monoclonal antibody.
(1 Publication)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Metallothionein-1B
Overexpression Lysate ...
NBP2-10437
Western Blot: Metallothionein-1B Overexpression Lysate (Adult Normal) [NBP2-10437] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Metallothionein-1B.
Species: Hu
MTTP Antibody
NBP1-62489
Western Blot: MTTP Antibody [NBP1-62489] - Adult mouse small intestine homogenate, 20 ug total protein per lane. Antibody at 1:1000. Secondary HRP conjugated antibody at 1:5000. Bands visualized with Western Chemiluminescence HRP substrate, imaged with Syngene imaging system. WB image submitted by a verified customer review.
Western Blot: MTTP Antibody [NBP1-62489] - HepG2 cell lysate.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
IRF1 Antibody
AF4715
Western blot shows lysates of NIH-3T3 mouse embryonic fibroblast cell line. Gels were loaded with 30 μg of whole cell lysate (WCL), 20 μg of cytoplasmic (Cyto), and 10 μg of nuclear extracts (Nuc). PVDF membrane was probed with 1 µg/mL Mouse IRF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4715) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band for IRF1 was detected at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Mu
Applications: WB
GBP1 Antibody
NBP2-03972
Western Blot: GBP1 Antibody [NBP2-03972] - Analysis of GBP1 using GBP1 polyclonal antibody. Human HCT-116 lysate in the absence (1) and presence (2) of immunizing peptide and mouse RAW cell lysate (3) probed with GBP1 antibody at 3 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: GBP1 Antibody [NBP2-03972] - Analysis of GBP1 using GBP1 polyclonal antibody. Human rectum tissue probed with GBP1 antibody at 5 ug/ml.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Recombinant Human
Gastrin Protein
H00002520-P01
SDS-Page: Recombinant Human Gastrin peptide Protein [H00002520-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
(2 Publications)
Species: Hu
Axin-1 Antibody
AF3287
Western blot shows lysates of Raji human Burkitt's lymphoma cell line, Balb/3T3 mouse embryonic fibroblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Human/Mouse/Rat Axin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3287) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Axin-1 at approximately 120 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB
HADHB Antibody
NBP1-82609
Western Blot: HADHB Antibody [NBP1-82609] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Western Blot: HADHB Antibody [NBP1-82609] - Analysis using Anti-HADHB antibody NBP1-82609 (A) shows similar pattern to independent antibody NBP2-38353 (B).
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
RNF23 Antibody
NBP2-20183
Western Blot: RNF23 Antibody [NBP2-20183] - Sample (50 ug of whole cell lysate) A: Rat testis, 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RNF23 Antibody [NBP2-20183] - RNF23 antibody detects TRIM39 protein at cytosol on human colon carcinoma by immunohistochemical analysis. Sample: Paraffin-embedded colon carcinoma.RNF23 antibody dilution: 1:500.
Western Blot: RNF23 Antibody [NBP2-20183] - Sample (30 ug of whole cell lysate) A: A431 7. 5% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
beta-Catenin
Antibody [Unconjugate
AF1329
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, C6 rat glioma cell line, and NIH-3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL Goat Anti-Human/Mouse/Rat beta ‑Catenin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1329) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human beta -catenin (1 ng) was included. A specific band for beta-Catenin was detected at approximately 95 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
beta -Catenin was detected in immersion fixed paraffin-embedded sections of human kidney cancer tissue using Goat Anti-Human/Mouse/Rat beta -Catenin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1329) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
HeLa human cervical epithelial carcinoma cell line were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. beta ‑Catenin/DNA complexes were immuno­precipitated using 5 μg Goat Anti-Human/Mouse/Rat beta ‑Catenin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1329) or control antibody (Catalog # AB‑108‑C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immuno­complexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The SU(Z)12 promoter was detected by standard PCR.
(4 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ChIP, CyTOF-ready, ICC, ICFlow
EHHADH Antibody
NBP1-84915
Western Blot: EHHADH Antibody [NBP1-84915] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: EHHADH Antibody [NBP1-84915] - Staining in human liver and cerebral cortex tissues using anti-EHHADH antibody. Corresponding EHHADH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EHHADH Antibody [NBP1-84915] - Staining of human cerebral cortex shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
IFN-alpha 1
Antibody
NBP2-75930
Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: IFN-alpha 1 Antibody [NBP2-75930] - analysis of paraffin-embedded mouse brain tissue tissue using anti-IFNA1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
ACADS Antibody
NBP1-89290
Western Blot: ACADS Antibody [NBP1-89290] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: ACADS Antibody [NBP1-89290] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Analysis in human duodenum and tonsil tissues. Corresponding ACADS RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HADHA Antibody (NBP1-83387)(1)


Reviews for HADHA Antibody (NBP1-83387) (0)

There are no reviews for HADHA Antibody (NBP1-83387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HADHA Antibody (NBP1-83387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

HADHA Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional HADHA Products

Bioinformatics Tool for HADHA Antibody (NBP1-83387)

Discover related pathways, diseases and genes to HADHA Antibody (NBP1-83387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HADHA Antibody (NBP1-83387)

Discover more about diseases related to HADHA Antibody (NBP1-83387).
 

Pathways for HADHA Antibody (NBP1-83387)

View related products by pathway.

PTMs for HADHA Antibody (NBP1-83387)

Learn more about PTMs related to HADHA Antibody (NBP1-83387).

Blogs on HADHA

There are no specific blogs for HADHA, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HADHA Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HADHA
COVID-19 update