LYVE-1 Antibody - BSA Free Summary
| Immunogen |
This LYVE-1 Antibody was developed against a recombinant protein corresponding to amino acids: FETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LYVE1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Theoretical MW |
35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for LYVE-1 Antibody - BSA Free
Background
LYVE-1 (Lymphatic Vessel Endothelial Receptor 1) is a receptor for the extracellular matrix mucopolysaccharide hyaluronan (HA) and is primarily expressed by lymphatic endothelial cells in addition to the sinusoidal endothelium of the liver and spleen (1-3). HA, also called hyaluronic acid, is a main component of the extracellular matrix and functions largely in cell adhesion, migration, and tissue remodeling (2). HA undergoes a turnover process that involves release from the tissues to the afferent lymph, degradation within the lymph nodes, and removal of fragments by the liver (2,3). LYVE-1, in addition to other lymphatic proteins including VEGFR3, Prox1, and podoplanin, is a common marker for differentiating between the blood and lymphatic systems (2,3). Furthermore, LYVE-1 is closely related to the leukocyte receptor CD44, having ~44% sequence similarity (1-3). Like CD44, the LYVE-1 protein contains an extracellular HA-binding link domain, with N- and C-terminal extensions, located at the end of a glycosylated juxtamembrane domain stalk region, followed by a transmembrane region, and a cytoplasmic tail (1-3). The key features of the HA-binding like molecule are the three disulfide bridges formed by six cysteine residues (1-3). LYVE-1 is synthesized as a protein of 322 amino acids in length with a theoretical molecular weight of 35 kDa, although due to O-glycosylation often appears in SDS-PAGE at a molecular weight ranging from ~60-70 kDa (2,4). The role of HA-binding is further elucidated by the identification of LYVE-1 as a docking receptor for dendritic cells and macrophages, binding their surface HA to control the entry and migration into lymph vessels (1).
LYVE-1 has been an important marker in studies of embryonic and tumor lymphangiogenesis, as many cancers are characterized by early metastasis to the lymph nodes (1-3, 5). One study of five different vascular tumors in infants used immunohistochemical analysis and found positive LYVE-1 expression in infantile hemangioma, tufted angioma, and kaposiform hemangioendothelioma (5). LYVE-1 along with other markers such as GLUT-1, CD31, CD34, Prox-1, and WT-1 can be used to help provide immunohistologic profiles of various tumors and, when used in conjunction with clinical and histopathologic approaches, may offer better overall diagnosis and disease treatment (5).
References
1. Jackson D. G. (2019). Hyaluronan in the lymphatics: The key role of the hyaluronan receptor LYVE-1 in leucocyte trafficking. Matrix Biology : Journal of the International Society for Matrix Biology. https://doi.org/10.1016/j.matbio.2018.02.001
2. Jackson D. G. (2004). Biology of the lymphatic marker LYVE-1 and applications in research into lymphatic trafficking and lymphangiogenesis. APMIS : acta pathologica, microbiologica, et immunologica Scandinavica. https://doi.org/10.1111/j.1600-0463.2004.apm11207-0811.x
3. Jackson D. G. (2003). The lymphatics revisited: new perspectives from the hyaluronan receptor LYVE-1. Trends in Cardiovascular Medicine. https://doi.org/10.1016/s1050-1738(02)00189-5
4. Unitprot (Q9Y5Y7)
5. Johnson, E. F., Davis, D. M., Tollefson, M. M., Fritchie, K., & Gibson, L. E. (2018). Vascular Tumors in Infants: Case Report and Review of Clinical, Histopathologic, and Immunohistochemical Characteristics of Infantile Hemangioma, Pyogenic Granuloma, Noninvoluting Congenital Hemangioma, Tufted Angioma, and Kaposiform Hemangioendothelioma. The American Journal of Dermatopathology. https://doi.org/10.1097/DAD.0000000000000983
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Rt
Applications: IHC, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: BA
Publications for LYVE-1 Antibody (NBP2-38500) (0)
There are no publications for LYVE-1 Antibody (NBP2-38500).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LYVE-1 Antibody (NBP2-38500) (0)
There are no reviews for LYVE-1 Antibody (NBP2-38500).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LYVE-1 Antibody (NBP2-38500) (0)