Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen

Images

 

Order Details


    • Catalog Number
      NBP2-55314PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lysyl Oxidase Homolog 2/LOXL2.

Source: E. coli

Amino Acid Sequence: CKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LOXL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55314.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen

  • EC 1.4.3
  • EC 1.4.3.-
  • LOL2
  • LOR2
  • LOXL2
  • Lysyl Oxidase Homolog 2
  • lysyl oxidase related 2
  • lysyl oxidase-like 2
  • Lysyl oxidase-like protein 2
  • Lysyl oxidase-related protein 2
  • Lysyl oxidase-related protein WS9-14
  • WS9-14

Background

LOXL2 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2527
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-75964
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00004016-D01P
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00084171-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-807
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
AF3639
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
DGB300
Species: Hu
Applications: ELISA
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
DMP900
Species: Hu
Applications: ELISA
DTM100
Species: Hu
Applications: ELISA
NBP1-86636
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-55314PEP
Species: Hu
Applications: AC

Publications for Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen (NBP2-55314PEP) (0)

There are no publications for Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen (NBP2-55314PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen (NBP2-55314PEP) (0)

There are no reviews for Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen (NBP2-55314PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen (NBP2-55314PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lysyl Oxidase Homolog 2/LOXL2 Products

Research Areas for Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen (NBP2-55314PEP)

Find related products by research area.

Blogs on Lysyl Oxidase Homolog 2/LOXL2

There are no specific blogs for Lysyl Oxidase Homolog 2/LOXL2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LOXL2