![Immunocytochemistry/Immunofluorescence: LYPLAL1 Antibody [NBP1-92090] - Staining of human cell line U-251 MG shows positivity in cytoplasm.](http://images.novusbio.com/fullsize2/LYPLAL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92090-img0003.jpg "Immunocytochemistry/Immunofluorescence: LYPLAL1 Antibody [NBP1-92090] - Staining of human cell line U-251 MG shows positivity in cytoplasm.")
| Reactivity | HuSpecies Glossary |
| Applications | Simple Western, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LYPLAL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Simple western reported by an internal validation. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurexin 3/NRXN3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5269_human-mouse-neurexin-3-affinity-purified-polyclonal-ab-immunohistochemistry-2682022134435.jpg)
![Western Blot Neurexin 3/NRXN3 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5269_human-mouse-neurexin-3-affinity-purified-polyclonal-ab-western-blot-612023112046.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for LYPLAL1 Antibody (NBP1-92090)Discover more about diseases related to LYPLAL1 Antibody (NBP1-92090).
| Pathways for LYPLAL1 Antibody (NBP1-92090)View related products by pathway.
|
PTMs for LYPLAL1 Antibody (NBP1-92090)Learn more about PTMs related to LYPLAL1 Antibody (NBP1-92090).
| Research Areas for LYPLAL1 Antibody (NBP1-92090)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LYPLAL1 |
![Immunohistochemistry-Paraffin: LYPLAL1 Antibody [NBP1-92090] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules and in glomeruli.](http://images.novusbio.com/fullsize2/LYPLAL1-Antibody-Immunohistochemistry-Paraffin-NBP1-92090-img0006.jpg "Immunohistochemistry-Paraffin: LYPLAL1 Antibody [NBP1-92090] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules and in glomeruli.")
![Simple Western: LYPLAL1 Antibody [NBP1-92090] - Lane view shows a specific band for LYPLA1 using 200 ug/mL of Sk-Mel-28 cell lysate and 1:4 antibody dilution. Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 32 kDa. Image from an internal validation.](http://images.novusbio.com/fullsize2/LYPLAL1-Antibody-Simple-Western-NBP1-92090-img0008.jpg "Simple Western: LYPLAL1 Antibody [NBP1-92090] - Lane view shows a specific band for LYPLA1 using 200 ug/mL of Sk-Mel-28 cell lysate and 1:4 antibody dilution. Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 32 kDa. Image from an internal validation.")
![BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
-Immunocytochemistry-Immunofluorescence-H00010434-M05-img0001.jpg)
-Western-Blot-H00010434-M05-img0003.jpg)
-Sandwich-ELISA-H00010434-M05-img0002.jpg)
![VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot PEDFR/PNPLA2/ATGL Antibody [Unconjugated]](https://images.novusbio.com/images2/PEDF_R_AF5365_Western_Blot_5700.jpg)
![Simple Western PEDFR/PNPLA2/ATGL Antibody [Unconjugated]](https://images.novusbio.com/images2/PEDF_R_AF5365_Simple_Western_17547.jpg)
![Immunohistochemistry PEDFR/PNPLA2/ATGL Antibody [Unconjugated]](https://images.novusbio.com/images2/PEDF_R_AF5365_Immunohistochemistry_6870.jpg)
-Flow-Cytometry-H00006890-M04-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-H00006890-M04-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")