LYPLA1 Antibody (3D5) - Azide and BSA Free

Western Blot: LYPLA1 Antibody (3D5) [H00010434-M05] - Analysis of LYPLA1 expression in transfected 293T cell line by LYPLA1 monoclonal antibody (M05), clone 3D5. Lane 1: LYPLA1 transfected lysatE (24.7 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: LYPLA1 Antibody (3D5) [H00010434-M05] - Analysis of monoclonal antibody to LYPLA1 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: LYPLA1 Antibody (3D5) [H00010434-M05] - Detection limit for recombinant GST tagged LYPLA1 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 3D5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LYPLA1 Antibody (3D5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LYPLA1 Antibody (3D5) - Azide and BSA Free (H00010434-M05) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. Anti-LYPLA1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LYPLA1 (AAH08652.1, 66 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS
• Specificity: LYPLA1 - lysophospholipase I (3D5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LYPLA1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500

Reactivity Notes

Rat reactivity reported in scientific literature (PMID:32927904)

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LYPLA1 Antibody (3D5) - Azide and BSA Free

• acyl-protein thioesterase-1
• APT1
• APT-1
• EC 3.1.2
• EC 3.1.2.-
• EC 3.1.2.22
• hAPT1
• LPL1
• LPL1acyl-protein thioesterase 1
• LPL-I
• LYPLA1
• Lysophospholipase 1
• Lysophospholipase I
• lysophospholipase ILYSOPLA
• lysophospholipid-specific lysophospholipase
• LysoPLA I

Background

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LYPLA1 Antibody (H00010434-M05)(2)

Publications using H00010434-M05

• GarcIa-IbANez Y, Riesco-Eizaguirre G, Santisteban P et al. RAS Subcellular Localization Inversely Regulates Thyroid Tumor Growth and Dissemination Cancers 2020-09-10 [PMID: 32927904] (WB, Rat)
• Hirano T, Kishi M, Sugimoto H et al. Thioesterase activity and subcellular localization of acylprotein thioesterase 1/lysophospholipase 1. Biochim Biophys Acta. 2009-05-08 [PMID: 19439193]

Bioinformatics

• Gene Symbol: LYPLA1
• Entrez:
  • 10434(Human)
• Uniprot:
  • AAH08652(Human)