LYPLA3 Antibody

Images

 
Western Blot: LYPLA3 Antibody [NBP1-92088] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human lymph node.
Western Blot: LYPLA3 Antibody [NBP1-92088] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human placenta shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining in human placenta and pancreas tissues using anti-PLA2G15 antibody. Corresponding PLA2G15 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human colon, lymph node, pancreas and placenta using Anti-PLA2G15 antibody NBP1-92088 (A) shows similar protein distribution across tissues to ...read more
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LYPLA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED
Specificity
Specificity of human LYPLA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLA2G15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
LYPLA3 Lysate (NBP2-66106)
Control Peptide
LYPLA3 Protein (NBP1-92088PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYPLA3 Antibody

  • 1-O-acylceramide synthase
  • ACSDKFZp564A0122
  • EC 2.3.1.43
  • GXVPLA2
  • LLPLLCAT-like lysophospholipase
  • LPLA2group XV phospholipase A2
  • LYPLA3EC 2.3.1.-
  • lysophospholipase 3 (lysosomal phospholipase A2)
  • Lysophospholipase 3
  • Lysosomal phospholipase A2
  • phospholipase A2, group XV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-31995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-92088
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for LYPLA3 Antibody (NBP1-92088) (0)

There are no publications for LYPLA3 Antibody (NBP1-92088).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYPLA3 Antibody (NBP1-92088) (0)

There are no reviews for LYPLA3 Antibody (NBP1-92088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYPLA3 Antibody (NBP1-92088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for LYPLA3 Antibody (NBP1-92088)

Discover related pathways, diseases and genes to LYPLA3 Antibody (NBP1-92088). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LYPLA3

There are no specific blogs for LYPLA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYPLA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G15