LYPLA3 Antibody


Western Blot: LYPLA3 Antibody [NBP1-92088] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human lymph node.
Western Blot: LYPLA3 Antibody [NBP1-92088] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human placenta shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining in human placenta and pancreas tissues using anti-PLA2G15 antibody. Corresponding PLA2G15 RNA-seq data are presented more
Independent Antibodies: Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human colon, lymph node, pancreas and placenta using Anti-PLA2G15 antibody NBP1-92088 (A) shows similar protein more
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human colon.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

LYPLA3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED
Specificity of human LYPLA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
LYPLA3 Lysate (NBP2-66106)
Control Peptide
LYPLA3 Protein (NBP1-92088PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LYPLA3 Antibody

  • 1-O-acylceramide synthase
  • ACSDKFZp564A0122
  • EC
  • LLPLLCAT-like lysophospholipase
  • LPLA2group XV phospholipase A2
  • LYPLA3EC 2.3.1.-
  • lysophospholipase 3 (lysosomal phospholipase A2)
  • Lysophospholipase 3
  • Lysosomal phospholipase A2
  • phospholipase A2, group XV


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for LYPLA3 Antibody (NBP1-92088) (0)

There are no publications for LYPLA3 Antibody (NBP1-92088).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYPLA3 Antibody (NBP1-92088) (0)

There are no reviews for LYPLA3 Antibody (NBP1-92088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYPLA3 Antibody (NBP1-92088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for LYPLA3 Antibody (NBP1-92088)

Discover related pathways, diseases and genes to LYPLA3 Antibody (NBP1-92088). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LYPLA3

There are no specific blogs for LYPLA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LYPLA3 Antibody and receive a gift card or discount.


Gene Symbol PLA2G15