Lymphotoxin-alpha/TNF-beta Antibody

Images

 
Western Blot: Lymphotoxin-alpha/TNF-beta Antibody [NBP1-87725] - Analysis in control (vector only transfected HEK293T lysate) and lTA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: Lymphotoxin-alpha/TNF-beta Antibody [NBP1-87725] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lymphotoxin-alpha/TNF-beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LTA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
Lymphotoxin-alpha/TNF-beta Protein (NBP1-87725PEP)
Publications
Read Publication using
NBP1-87725 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24566624).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lymphotoxin-alpha/TNF-beta Antibody

  • LT
  • LTA
  • LT-alpha
  • lymphotoxin alpha (TNF superfamily, member 1)
  • Lymphotoxin alpha
  • Lymphotoxinalpha
  • Lymphotoxin-alpha
  • tnfb
  • TNF-beta
  • TNFBlymphotoxin-alpha
  • TNFSF1
  • TNFSF1B
  • TNFSF1TNF-beta
  • tumor necrosis factor beta
  • Tumor necrosis factor ligand superfamily member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready

Publications for Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725) (0)

There are no reviews for Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lymphotoxin-alpha/TNF-beta Products

Bioinformatics Tool for Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725)

Discover related pathways, diseases and genes to Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725)

Discover more about diseases related to Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725).
 

Pathways for Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725)

View related products by pathway.

PTMs for Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725)

Learn more about PTMs related to Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725).
 

Research Areas for Lymphotoxin-alpha/TNF-beta Antibody (NBP1-87725)

Find related products by research area.

Blogs on Lymphotoxin-alpha/TNF-beta

There are no specific blogs for Lymphotoxin-alpha/TNF-beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lymphotoxin-alpha/TNF-beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTA
Entrez