Lymphotoxin beta/TNFSF3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human cell line RT4 shows localization to centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human small intestine shows moderate positivity in leukocytes.

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non germinal and germinal center cells.

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human cerebral cortex shows very weak positivity in neurons.

Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human tonsil shows moderate positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Lymphotoxin beta/TNFSF3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Lymphotoxin beta/TNFSF3 Antibody - BSA Free (NBP2-14207) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LTB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Lymphotoxin beta/TNFSF3 Protein (NBP2-14207PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

• LTB
• lymphotoxin beta (TNF superfamily, member 3)
• Lymphotoxin beta
• lymphotoxin-beta
• p33
• TNFCTNF-C
• TNFSF3
• TNFSF3LT-beta
• Tumor necrosis factor C
• Tumor necrosis factor ligand superfamily member 3

Background

Tumor necrosis factor (TNF) and lymphotoxin-alpha (LT-alpha, also known as TNF beta) are members of a family of secreted and cell surface cytokines that participate in the regulation of immune and inflammatory responses. LT-beta (lymphotaxin-beta or tumor necrosis factor C) is a type II membrane protein with significant homology to TNF, LT-alpha, and the ligand for the CD40 receptor. LT-alpha is present on the surface of activated T, B, and LAK cells as a complex with the 33 kda glycoprotein, LT-beta. LT-beta, also expressed by active lymphocytes, forms a heterotrimer with LT-a on the cell surface and anchors LT-alpha to the cell surface. A TNF receptor-related protein, the LT-beta receptor (also known as TNFC receptor), is the human receptor for the LT-alpha/LT-beta heterotrimer. There are two LT-beta isoforms expressed in human lymphoid cell lines and non-Hodgkin's lymphomas. The gene which encodes LT-beta maps to the major histocompatibility complex region on human chromosome 6p21.3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LTB