Lymphotoxin beta/TNFSF3 Antibody


Immunocytochemistry/ Immunofluorescence: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Immunofluorescent staining of human cell line RT4 shows localization to centrosome.
Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non germinal and germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Lymphotoxin beta/TNFSF3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQG LGWETTKEQAFLTSGTQFSD
Specificity of human Lymphotoxin beta/TNFSF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Lymphotoxin beta/TNFSF3 Protein (NBP2-14207PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Lymphotoxin beta/TNFSF3 Antibody

  • LTB
  • lymphotoxin beta (TNF superfamily, member 3)
  • Lymphotoxin beta
  • lymphotoxin-beta
  • p33
  • TNFSF3
  • TNFSF3LT-beta
  • Tumor necrosis factor C
  • Tumor necrosis factor ligand superfamily member 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207) (0)

There are no publications for Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207) (0)

There are no reviews for Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Lymphotoxin beta/TNFSF3 Products

Bioinformatics Tool for Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207)

Discover related pathways, diseases and genes to Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207)

Discover more about diseases related to Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207).

Pathways for Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207)

View related products by pathway.

PTMs for Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207)

Learn more about PTMs related to Lymphotoxin beta/TNFSF3 Antibody (NBP2-14207).

Blogs on Lymphotoxin beta/TNFSF3

There are no specific blogs for Lymphotoxin beta/TNFSF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Lymphotoxin beta/TNFSF3 Antibody and receive a gift card or discount.


Gene Symbol LTB