LXR alpha/NR1H3 Antibody - BSA Free

Western Blot: LXR alpha/NR1H3 Antibody [NBP1-92086] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: LXR alpha/NR1H3 Antibody [NBP1-92086] - Staining of human testis shows moderate cytoplasmic positivity in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LXR alpha/NR1H3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NR1H3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LXR alpha/NR1H3 Protein (NBP1-92086PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LXR alpha/NR1H3 Antibody - BSA Free

• alpha
• Liver X receptor alpha
• liver X receptor-alpha
• LXR alpha
• LXRA
• NR1H3
• Nuclear receptor subfamily 1 group H member 3
• nuclear receptor subfamily 1, group H, member 3
• oxysterols receptor LXR-alpha
• RLD-1

Background

Liver X Receptors (LXRs) are oxysterol activated nuclear receptors which are involved in the regulation of cholesterol metabolism and bile acids. Two known isoforms, alpha and beta, are differentially expressed. The alpha isoform is predominantly expressed in liver, whereas the beta isoform expression has been shown to be ubiquitous.

LXR antibodies are useful for lipid and cholesterol metabolism studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NR1H3