LSECtin/CLEC4G Antibody

Images

 
Immunohistochemistry-Paraffin: LSECtin/CLEC4G Antibody [NBP1-82815] - Staining of human liver shows distinct positivity in sinusoids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LSECtin/CLEC4G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLEC4G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LSECtin/CLEC4G Protein (NBP1-82815PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LSECtin/CLEC4G Antibody

  • CLEC4G
  • C-type lectin domain family 4 member G
  • C-type lectin domain family 4, member G
  • C-type lectin superfamily 4, member G
  • DTTR431
  • liver and lymph node sinusoidal endothelial cell C-type lectin
  • LP2698
  • LSECtin
  • Q6UXB4
  • UNQ431

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB162
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
NBP1-83054
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC

Publications for LSECtin/CLEC4G Antibody (NBP1-82815) (0)

There are no publications for LSECtin/CLEC4G Antibody (NBP1-82815).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSECtin/CLEC4G Antibody (NBP1-82815) (0)

There are no reviews for LSECtin/CLEC4G Antibody (NBP1-82815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LSECtin/CLEC4G Antibody (NBP1-82815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LSECtin/CLEC4G Products

Bioinformatics Tool for LSECtin/CLEC4G Antibody (NBP1-82815)

Discover related pathways, diseases and genes to LSECtin/CLEC4G Antibody (NBP1-82815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSECtin/CLEC4G Antibody (NBP1-82815)

Discover more about diseases related to LSECtin/CLEC4G Antibody (NBP1-82815).
 

Pathways for LSECtin/CLEC4G Antibody (NBP1-82815)

View related products by pathway.

PTMs for LSECtin/CLEC4G Antibody (NBP1-82815)

Learn more about PTMs related to LSECtin/CLEC4G Antibody (NBP1-82815).

Blogs on LSECtin/CLEC4G

There are no specific blogs for LSECtin/CLEC4G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSECtin/CLEC4G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC4G
Entrez