LRSAM1 Antibody

Images

 
Western Blot: LRSAM1 Antibody [NBP1-82017] - Analysis in control (vector only transfected HEK293T lysate) and LRSAM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry: LRSAM1 Antibody [NBP1-82017] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRSAM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSSMAEMDERFQQILSWQQMDQNKAISQI
Specificity
Specificity of human LRSAM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRSAM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRSAM1 Protein (NBP1-82017PEP)
Publications
Read Publication using NBP1-82017.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23519028)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRSAM1 Antibody

  • EC 6.3.2.-
  • FLJ31641
  • hTAL
  • leucine rich repeat and sterile alpha motif containing 1
  • Leucine-rich repeat and sterile alpha motif-containing protein 1
  • RIFLE
  • TALE3 ubiquitin-protein ligase LRSAM1
  • Tsg101-associated ligase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-50321
Species: Hu, Ca
Applications: IHC, IHC-Fr, IHC-P, IF
NBP1-82874
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
H00010686-M02
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33757
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM, KD
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82017
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for LRSAM1 Antibody (NBP1-82017)(1)

Reviews for LRSAM1 Antibody (NBP1-82017) (0)

There are no reviews for LRSAM1 Antibody (NBP1-82017). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRSAM1 Antibody (NBP1-82017) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRSAM1 Products

Bioinformatics Tool for LRSAM1 Antibody (NBP1-82017)

Discover related pathways, diseases and genes to LRSAM1 Antibody (NBP1-82017). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRSAM1 Antibody (NBP1-82017)

Discover more about diseases related to LRSAM1 Antibody (NBP1-82017).
 

Pathways for LRSAM1 Antibody (NBP1-82017)

View related products by pathway.

PTMs for LRSAM1 Antibody (NBP1-82017)

Learn more about PTMs related to LRSAM1 Antibody (NBP1-82017).
 

Research Areas for LRSAM1 Antibody (NBP1-82017)

Find related products by research area.

Blogs on LRSAM1

There are no specific blogs for LRSAM1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRSAM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRSAM1