LRRFIP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LRRFIP1 Antibody [NBP1-84665] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: LRRFIP1 Antibody [NBP1-84665] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.

ChIP-Exo-Seq composite graph for Anti-LRRFIP1 (NBP1-84665) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LRRFIP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LRRFIP1 Antibody - BSA Free (NBP1-84665) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KTEVPGSPAGTEGNCQEATGPSTVDTQNEPLDMKEPDEEKSDQQGEALDSSQKKTKNKKKKNKKKKSPVPVETLKDVKKELTYQNTDLSEIKEEEQVKSTDRKSAVEAQNEVTENPKQKIAAESSENVDCPENPKIKLDGKLDQEGDDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRFIP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LRRFIP1 Protein (NBP1-84665PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LRRFIP1 Antibody - BSA Free

• FLAP-1
• FLIIAP1
• GC-binding factor 2
• GCF2
• GCF-2
• HUFI-1
• leucine rich repeat (in FLII) interacting protein 1
• leucine-rich repeat flightless-interacting protein 1
• LRR FLII-interacting protein 1
• MGC10947
• MGC119738
• MGC119739
• NEDD8-conjugating enzyme
• TRIPTAR RNA-interacting protein

Background

Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRRFIP1
• Entrez:
  • 9208(Human)
• Uniprot:
  • Q32MZ4(Human)