LRRFIP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRRFIP1 Antibody [NBP1-84665] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: LRRFIP1 Antibody [NBP1-84665] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRFIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KTEVPGSPAGTEGNCQEATGPSTVDTQNEPLDMKEPDEEKSDQQGEALDSSQKKTKNKKKKNKKKKSPVPVETLKDVKKELTYQNTDLSEIKEEEQVKSTDRKSAVEAQNEVTENPKQKIAAESSENVDCPENPKIKLDGKLDQEGDDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRFIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRFIP1 Protein (NBP1-84665PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRFIP1 Antibody

  • FLAP-1
  • FLIIAP1
  • GC-binding factor 2
  • GCF2
  • GCF-2
  • HUFI-1
  • leucine rich repeat (in FLII) interacting protein 1
  • leucine-rich repeat flightless-interacting protein 1
  • LRR FLII-interacting protein 1
  • MGC10947
  • MGC119738
  • MGC119739
  • NEDD8-conjugating enzyme
  • TRIPTAR RNA-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-03822
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27199
Species: Hu, Eq, Pm
Applications: IHC-P
NBP1-59632
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP1-55035
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
NBP1-84665
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LRRFIP1 Antibody (NBP1-84665) (0)

There are no publications for LRRFIP1 Antibody (NBP1-84665).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRFIP1 Antibody (NBP1-84665) (0)

There are no reviews for LRRFIP1 Antibody (NBP1-84665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRFIP1 Antibody (NBP1-84665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRFIP1 Products

Bioinformatics Tool for LRRFIP1 Antibody (NBP1-84665)

Discover related pathways, diseases and genes to LRRFIP1 Antibody (NBP1-84665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRFIP1 Antibody (NBP1-84665)

Discover more about diseases related to LRRFIP1 Antibody (NBP1-84665).
 

Pathways for LRRFIP1 Antibody (NBP1-84665)

View related products by pathway.

PTMs for LRRFIP1 Antibody (NBP1-84665)

Learn more about PTMs related to LRRFIP1 Antibody (NBP1-84665).

Blogs on LRRFIP1

There are no specific blogs for LRRFIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRFIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRFIP1
Entrez
Uniprot