LRG1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Analysis in human liver and cerebral cortex tissues. Corresponding LRG1 RNA-seq data are presented for the same tissues.
Western Blot: LRG1 Antibody [NBP1-82823] - Analysis in human plasma.
Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Staining of human cerebral cortex shows very weak cytoplasmic positivity in a subset of neurons.
Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Staining of human fallopian tube shows moderate positivity in plasma.
Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Staining of human colon shows weak to moderate positivity in plasma.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LRG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC, WB reported in scientific literature (PMID: 23868260). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRG1 Protein (NBP1-82823PEP)
Publications
Read Publications using
NBP1-82823 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23868260).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRG1 Antibody

  • 1300008B03Rik
  • 2310031E04Rik
  • HMFT1766
  • leucine-rich alpha-2-glycoprotein 1
  • leucine-rich alpha-2-glycoprotein
  • LRG1
  • LRGleucine rich alpha 2 glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DCLU00
Species: Hu
Applications: ELISA
DCRP00
Species: Hu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
2914-HT
Species: Hu
Applications: BA
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-90309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
MAB868
Species: Hu
Applications: WB
NBP2-42526
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF-241-NA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
NBP1-81858
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-24664
Species: Hu, Mu, Rt
Applications: Flow, WB

Publications for LRG1 Antibody (NBP1-82823)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for LRG1 Antibody (NBP1-82823) (0)

There are no reviews for LRG1 Antibody (NBP1-82823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRG1 Antibody (NBP1-82823) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRG1 Products

Bioinformatics Tool for LRG1 Antibody (NBP1-82823)

Discover related pathways, diseases and genes to LRG1 Antibody (NBP1-82823). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRG1 Antibody (NBP1-82823)

Discover more about diseases related to LRG1 Antibody (NBP1-82823).
 

Pathways for LRG1 Antibody (NBP1-82823)

View related products by pathway.

PTMs for LRG1 Antibody (NBP1-82823)

Learn more about PTMs related to LRG1 Antibody (NBP1-82823).
 

Research Areas for LRG1 Antibody (NBP1-82823)

Find related products by research area.

Blogs on LRG1

There are no specific blogs for LRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRG1