LRG1 Antibody - BSA Free

Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Analysis in human liver and cerebral cortex tissues. Corresponding LRG1 RNA-seq data are presented for the same tissues.

Western Blot: LRG1 Antibody [NBP1-82823] - Analysis in human plasma.

Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Staining of human cerebral cortex shows very weak cytoplasmic positivity in a subset of neurons.

Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Staining of human fallopian tube shows moderate positivity in plasma.

Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82823] - Staining of human colon shows weak to moderate positivity in plasma.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LRG1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  LRG1 Protein (NBP1-82823PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23868260).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LRG1 Antibody - BSA Free

• 1300008B03Rik
• 2310031E04Rik
• HMFT1766
• leucine-rich alpha-2-glycoprotein 1
• leucine-rich alpha-2-glycoprotein
• LRG1
• LRGleucine rich alpha 2 glycoprotein

Background

The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LRG1 Antibody (NBP1-82823)(2)

Publications using NBP1-82823

• Wang X, Abraham S, McKenzie JA et al. LRG1 promotes angiogenesis by modulating endothelial TGFss signalling. Nature 2013-07-18 [PMID: 23868260] (IF/IHC, WB, Mouse)
• Linden M, Segersten U, Runeson M et al. Tumour expression of bladder cancer-associated urinary proteins. BJU Int 2013-08-01 [PMID: 23470167]

Bioinformatics

• Gene Symbol: LRG1