Aquaporin-4 Antibody


Western Blot: Aquaporin-4 Antibody [NBP1-87679] - Analysis in human brain tissue.
Immunocytochemistry/ Immunofluorescence: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human stomach shows strong membranous positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Analysis in human cerebral cortex and liver tissues. Corresponding AQP4 RNA-seq data are presented for the same tissues.
Immunohistochemistry: Aquaporin-4 Antibody [NBP1-87679] - Staining of mouse basal forebrain shows positivity in a subset of astrocytes in the caudate putamen.
Immunohistochemistry: Aquaporin-4 Antibody [NBP1-87679] - Staining of mouse cerebellum shows positivity in astrocytes, mainly in the molecular layer.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cerebellum shows moderate to strong membranous positivity in astrocytes, mainly in the molecular layer.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cerebral cortex shows moderate to strong membranous positivity in astrocytes.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human liver shows no positivity in hepatocytes, as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Aquaporin-4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Astrocytes Marker
Specificity of human, mouse Aquaporin-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Aquaporin-4 Recombinant Protein Antigen (NBP1-87679PEP)
Read Publications using
NBP1-87679 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24610630).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Aquaporin-4 Antibody

  • aquaporin 4
  • MGC22454


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Aquaporin-4 Antibody (NBP1-87679)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Aquaporin-4 Antibody (NBP1-87679) (0)

There are no reviews for Aquaporin-4 Antibody (NBP1-87679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aquaporin-4 Antibody (NBP1-87679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Aquaporin-4 Antibody (NBP1-87679)

Discover related pathways, diseases and genes to Aquaporin-4 Antibody (NBP1-87679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aquaporin-4 Antibody (NBP1-87679)

Discover more about diseases related to Aquaporin-4 Antibody (NBP1-87679).

Pathways for Aquaporin-4 Antibody (NBP1-87679)

View related products by pathway.

PTMs for Aquaporin-4 Antibody (NBP1-87679)

Learn more about PTMs related to Aquaporin-4 Antibody (NBP1-87679).

Blogs on Aquaporin-4

There are no specific blogs for Aquaporin-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Aquaporin-4 Antibody and receive a gift card or discount.


Gene Symbol AQP4