Aquaporin-4 Antibody

Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Analysis in human cerebral cortex and liver tissues. Corresponding AQP4 RNA-seq data are presented for the same tissues.

Western Blot: Aquaporin-4 Antibody [NBP1-87679] - Analysis in human brain tissue.

Immunocytochemistry/Immunofluorescence: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - AQP4 rabbit (1:2500) was incubated overnight at 4C on human cerebral cortex and visualized using donkey anti-rabbit Alexa Fluor 488 (green). Image submitted by a verified customer review.

Immunohistochemistry: Aquaporin-4 Antibody [NBP1-87679] - Staining of mouse basal forebrain shows positivity in a subset of astrocytes in the caudate putamen.

Immunohistochemistry: Aquaporin-4 Antibody [NBP1-87679] - Staining of mouse cerebellum shows positivity in astrocytes, mainly in the molecular layer.

Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cerebellum shows moderate to strong membranous positivity in astrocytes, mainly in the molecular layer.

Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cerebral cortex shows moderate to strong membranous positivity in astrocytes.

Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human liver shows no positivity in hepatocytes, as expected.

Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human stomach shows strong membranous positivity in glandular cells.

Immunohistochemistry-Frozen: Aquaporin-4 Antibody [NBP1-87679] - Mouse trigeminal ganglion stained with Aquaporin-4 antibody at 1:5000. Image submitted by a verified customer review

• Reactivity: Hu, Mu, Rt, Bv
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Aquaporin-4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
• Marker: Astrocytes Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AQP4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Immunoprecipitation
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: Use in Immunoprecipitation reported in scientific literature (PMID: 32843684). WB reported in scientific literature (PMID: 26039099). Aquaporin-4 antibody validated for IHC-F, IHC-P from verified customer reviews. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Aquaporin-4 Recombinant Protein Antigen (NBP1-87679PEP)

Reactivity Notes

Use in Rat reported in scientific literature (PMID:33634832). Bovine reactivity reported in scientific literature (PMID: 31233960).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Aquaporin-4 Antibody

• AQP4
• AQP-4
• Aquaporin 4
• MGC22454
• MIWC
• WCH4

Background

The Aquaporin-4 gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selectivechannels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Twoalternatively spliced tra

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aquaporin-4 Antibody (NBP1-87679)(16)

Publications using NBP1-87679

• Zy?k M, Beretta C, Naia L et al. Amyloid-? accumulation in human astrocytes induces mitochondrial disruption and changed energy metabolism Journal of neuroinflammation 2023-02-20 [PMID: 36803838] (ICC/IF)
• Xu C, Wang F, Su C et al. Restoration of aquaporin-4 polarization in the spinal glymphatic system by metformin in rats with painful diabetic neuropathy Neuroreport 2023-02-01 [PMID: 36719843] (WB, IHC-P, Rat)
• Wang FX, Xu CL, Su C et al. beta-Hydroxybutyrate Attenuates Painful Diabetic Neuropathy via Restoration of the Aquaporin-4 Polarity in the Spinal Glymphatic System Frontiers in neuroscience 2022-07-11 [PMID: 35898407]
• Wang GQ, Wang FX, He YN, Lin JY Plasticity of the spinal glymphatic system in male SD rats with painful diabetic neuropathy induced by type 2 diabetes mellitus Journal of neuroscience research 2022-07-07 [PMID: 35796387]
• Xue Y, Gursky Z, Monte B et al. Sustained glymphatic transport and impaired drainage to the nasal cavity observed in multiciliated cell ciliopathies with hydrocephalus Fluids and barriers of the CNS 2022-03-05 [PMID: 35248089] (IHC-Fr, Mouse)
• Grabowska M, Michalek K, Kedzierska-Kapuza K et al. The long-term effects of rapamycin-based immunosuppressive protocols on the expression of renal aquaporins 1, 2, 3 and 4 water channels in rats Histology and histopathology 2021-02-26 [PMID: 33634832] (IHC-P, Rat)
• Chung SW, Kim JY, Yoon JP et al. Atrogin1-induced loss of aquaporin 4 in myocytes leads to skeletal muscle atrophy Sci Rep 2020-08-25 [PMID: 32843684] (IP, WB, Mouse, Human)
• Koundal S, Elkin R, Nadeem S et al. Optimal Mass Transport with Lagrangian Workflow Reveals Advective and Diffusion Driven Solute Transport in the Glymphatic System Sci Rep 2020-02-06 [PMID: 32029859] (IF/IHC, IHC-Fr, Rat)
• Seo B, Jeon K, Moon S, et al. Radiation-Induced Changes in Tumor Vessels and Microenvironment Contribute to Therapeutic Resistance in Glioblastoma Front Oncol 2019-11-15 [PMID: 31803626] (ICC/IF, Mouse)
• Denver P, D'Adamo H, Hu S et al. A Novel Model of Mixed Vascular Dementia Incorporating Hypertension in a Rat Model of Alzheimer's Disease Front Physiol 2019-10-24 [PMID: 31708792] (IHC-Fr, Rat)
• Lopez-Rodriguez AB, Acaz-Fonseca E, Viveros MP et al. Changes in Cannabinoid Receptors, Aquaporin 4 and Vimentin Expression after Traumatic Brain Injury in Adolescent Male Mice. Association with Edema and Neurological Deficit. PLoS One 2015-01-01 [PMID: 26039099] (WB, Mouse)
• Sareen D, Gowing G, Sahabian A et al. Human neural progenitor cells generated from induced pluripotent stem cells can survive, migrate, and integrate in the rodent spinal cord. J Comp Neurol 2014-08-15 [PMID: 24610630] (IF/IHC, ICC/IF, Human)
• Wypych A, Dunis?awska A, Grabowska M et al. Effects of three-month feeding high-fat diets with differentfatty acid composition on kidney histology and expressionof genes related to cellular stress and water-electrolytehomeostasis in mice Journal of Animal and Feed Sciences 2023-06-22 (IHC-P, Mouse)
• Michalek K, Grabowska M Investigating cellular location of aquaporins in the bovine kidney. A new view on renal physiology in cattle Res. Vet. Sci. 2019-06-11 [PMID: 31233960] (WB, Bovine)
• Lee W, Lyu Z, Park J et al. Microphysiological stroke model for systematic evaluation of neurorestorative potential of stem cell therapy Research Square 2021-03-19 (ICC/IF, Human)
• Lyu Z, Park J, Kim KM Et al. A neurovascular-unit-on-a-chip for the evaluation of the restorative potential of stem cell therapies for ischaemic stroke Nature biomedical engineering 2021-08-01 [PMID: 34385693] (ICC/IF, Human)

Reviews for Aquaporin-4 Antibody (NBP1-87679) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Human, Mouse.

reviewed by: Edward van Beelen IHC-P Human 12/24/2020

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Brain (cerebral cortex)
• Species: Human
• Lot: 3460

reviewed by: Verified Customer IHC-Fr Mouse 11/22/2018

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Trigeminal ganglia
• Species: Mouse
• Lot: C116291

Comments

• Comments: Mice were perfused with 0.9% saline and subsequently decapitated. The cerebrum was then dissected out of the cranium and the head was put in ~10mL of 4% PFA in 0.1M phosphate buffer overnight. The following morning the trigeminal ganglia were dissected and placed in 30% sucrose (sucrose dissolved in 0.1M phosphate buffer) for at least 48hr. The tissue was then blocked in OCT, frozen, cut at 10 microns (on a cryostat) and mounted on glass slides.
  
  Slides were washed three times with 1X PBS (diluted from a 10X stock (recipe available on thelabrat.com)) and blocked for 1hr in 1X PBS containing 0.2% triton X-100 and 10% goat serum. After the block, tissue was incubated overnight at room temperature in 1X PBS containing 0.2% triton X-100, 2% goat serum, 20mg/mL bovine serum albumin and the primary antibody diluted to a final concentration of 1:5000. The following morning the slides were washed twice with 1X PBS containing 0.2% tween-20 and once with 1X PBS. The slides were then incubated for 45 min (room temperature) in 1X PBS containing 0.2% triton X-100, 2% goat serum, 20mg/mL bovine serum albumin and 488-conjugated goat-anti rabbit secondary (ThermoFisher, 1:200).
  
  After the 45 min incubation period, slides were washed with washed twice with 1X PBS containing 0.2% tween 20 and once with 1X PBS. The slides were then coverslipped and mounted using vectashield mounting medium.

Bioinformatics

• Gene Symbol: AQP4
• Entrez:
  • 361(Human)
• Uniprot:
  • P55087(Human)