Aquaporin-4 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Analysis in human cerebral cortex and liver tissues. Corresponding AQP4 RNA-seq data are presented for the same tissues.
Western Blot: Aquaporin-4 Antibody [NBP1-87679] - Analysis in human brain tissue.
Immunocytochemistry/ Immunofluorescence: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - AQP4 rabbit (1:2500) was incubated overnight at 4C on human cerebral cortex and visualized using donkey anti-rabbit Alexa Fluor 488 (green). Image ...read more
Immunohistochemistry: Aquaporin-4 Antibody [NBP1-87679] - Staining of mouse basal forebrain shows positivity in a subset of astrocytes in the caudate putamen.
Immunohistochemistry: Aquaporin-4 Antibody [NBP1-87679] - Staining of mouse cerebellum shows positivity in astrocytes, mainly in the molecular layer.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cerebellum shows moderate to strong membranous positivity in astrocytes, mainly in the molecular layer.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cerebral cortex shows moderate to strong membranous positivity in astrocytes.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human liver shows no positivity in hepatocytes, as expected.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Frozen: Aquaporin-4 Antibody [NBP1-87679] - Mouse trigeminal ganglion stained with Aquaporin-4 antibody at 1:5000. Image submitted by a verified customer review

Product Details

Summary
Reactivity Hu, Mu, Rt, BvSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Aquaporin-4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Marker
Astrocytes Marker
Specificity
Specificity of human Aquaporin-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AQP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/mL
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Immunoprecipitation
Application Notes
Use in Immunoprecipitation reported in scientific literature (PMID: 32843684). WB reported in scientific literature (PMID: 26039099). Aquaporin-4 antibody validated for IHC-F, IHC-P from verified customer reviews. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Aquaporin-4 Recombinant Protein Antigen (NBP1-87679PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87679 in the following applications:

Publications
Read Publications using
NBP1-87679 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31708792). Bovine reactivity reported in scientific literature (PMID: 31233960).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aquaporin-4 Antibody

  • aquaporin 4
  • MGC22454

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-749
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-97927
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67247
Species: Hu
Applications: WB, ICC/IF
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-20149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
7954-GM/CF
Species: Hu
NBP1-30862
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-30865
Species: Hu
Applications: WB, IHC, IHC-P
AF009
Species: Hu
Applications: WB, IHC
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP1-87466
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87679
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Aquaporin-4 Antibody (NBP1-87679)(8)

We have publications tested in 4 confirmed species: Human, Mouse, Rat, Bovine.

We have publications tested in 6 applications: ICC/IF, IHC, IHC-Fr, IHC/IF, IP, WB.


Filter By Application
ICC/IF
(2)
IHC
(2)
IHC-Fr
(2)
IHC/IF
(1)
IP
(1)
WB
(3)
All Applications
Filter By Species
Human
(2)
Mouse
(3)
Rat
(3)
Bovine
(1)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-87679 Applications Species
Lopez-Rodriguez AB, Acaz-Fonseca E, Viveros MP et al. Changes in Cannabinoid Receptors, Aquaporin 4 and Vimentin Expression after Traumatic Brain Injury in Adolescent Male Mice. Association with Edema and Neurological Deficit. PLoS One 2015 [PMID: 26039099] (WB, Mouse) WB Mouse
Sareen D, Gowing G, Sahabian A et al. Human neural progenitor cells generated from induced pluripotent stem cells can survive, migrate, and integrate in the rodent spinal cord. J Comp Neurol 2014 Aug 15 [PMID: 24610630] (IHC, ICC/IF, Human) IHC, ICC/IF Human
Koundal S, Elkin R, Nadeem S et al. Glymphatic Optimal Mass Transport with Lagrangian Workflow Reveals Advective and Diffusion Driven Solute Transport bioRxiv Sep 4 2019 (IHC/IF, Rat) IHC/IF Rat
Chung SW, Kim JY, Yoon JP et al. Atrogin1-induced loss of aquaporin 4 in myocytes leads to skeletal muscle atrophy Sci Rep Aug 25 2020 [PMID: 32843684] (WB, IP, Human, Mouse) WB, IP Human, Mouse
Koundal S, Elkin R, Nadeem S et al. Optimal Mass Transport with Lagrangian Workflow Reveals Advective and Diffusion Driven Solute Transport in the Glymphatic System Sci Rep Feb 6 2020 [PMID: 32029859] (IHC-Fr, IHC, Rat) IHC-Fr, IHC Rat
Seo B, Jeon K, Moon S, et al. Radiation-Induced Changes in Tumor Vessels and Microenvironment Contribute to Therapeutic Resistance in Glioblastoma Front Oncol Nov 15 2019 [PMID: 31803626] (ICC/IF, Mouse) ICC/IF Mouse
Denver P, D'Adamo H, Hu S et al. A Novel Model of Mixed Vascular Dementia Incorporating Hypertension in a Rat Model of Alzheimer's Disease Front Physiol Oct 24 2019 [PMID: 31708792] (IHC-Fr, Rat) IHC-Fr Rat
Michalek K, Grabowska M Investigating cellular location of aquaporins in the bovine kidney. A new view on renal physiology in cattle Res. Vet. Sci. Jun 11 2019 [PMID: 31233960] (WB, Bovine) WB Bovine

Review for Aquaporin-4 Antibody (NBP1-87679) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-87679:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen Aquaporin-4 NBP1-87679
Enlarge
5
reviewed by:
Kevin Thorburn
IHC-Fr Mouse 11/22/2018
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedTrigeminal ganglia
SpeciesMouse
LotC116291

Comments

CommentsMice were perfused with 0.9% saline and subsequently decapitated. The cerebrum was then dissected out of the cranium and the head was put in ~10mL of 4% PFA in 0.1M phosphate buffer overnight. The following morning the trigeminal ganglia were dissected and placed in 30% sucrose (sucrose dissolved in 0.1M phosphate buffer) for at least 48hr. The tissue was then blocked in OCT, frozen, cut at 10 microns (on a cryostat) and mounted on glass slides.

Slides were washed three times with 1X PBS (diluted from a 10X stock (recipe available on thelabrat.com)) and blocked for 1hr in 1X PBS containing 0.2% triton X-100 and 10% goat serum. After the block, tissue was incubated overnight at room temperature in 1X PBS containing 0.2% triton X-100, 2% goat serum, 20mg/mL bovine serum albumin and the primary antibody diluted to a final concentration of 1:5000. The following morning the slides were washed twice with 1X PBS containing 0.2% tween-20 and once with 1X PBS. The slides were then incubated for 45 min (room temperature) in 1X PBS containing 0.2% triton X-100, 2% goat serum, 20mg/mL bovine serum albumin and 488-conjugated goat-anti rabbit secondary (ThermoFisher, 1:200).

After the 45 min incubation period, slides were washed with washed twice with 1X PBS containing 0.2% tween 20 and once with 1X PBS. The slides were then coverslipped and mounted using vectashield mounting medium.

Product General Protocols

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aquaporin-4 Antibody (NBP1-87679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Aquaporin-4 Products

Bioinformatics Tool for Aquaporin-4 Antibody (NBP1-87679)

Discover related pathways, diseases and genes to Aquaporin-4 Antibody (NBP1-87679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aquaporin-4 Antibody (NBP1-87679)

Discover more about diseases related to Aquaporin-4 Antibody (NBP1-87679).
 

Pathways for Aquaporin-4 Antibody (NBP1-87679)

View related products by pathway.

PTMs for Aquaporin-4 Antibody (NBP1-87679)

Learn more about PTMs related to Aquaporin-4 Antibody (NBP1-87679).

Blogs on Aquaporin-4

There are no specific blogs for Aquaporin-4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Kevin Thorburn
11/22/2018
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol AQP4
Entrez
Uniprot