LRG1 Antibody

Images

 
Western Blot: LRG1 Antibody [NBP1-82822] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: LRG1 Antibody [NBP1-82822] - Staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: LRG1 Antibody [NBP1-82822] - Staining of human lung shows distinct positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQND
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRG1 Protein (NBP1-82822PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRG1 Antibody

  • 1300008B03Rik
  • 2310031E04Rik
  • HMFT1766
  • leucine-rich alpha-2-glycoprotein 1
  • leucine-rich alpha-2-glycoprotein
  • LRG1
  • LRGleucine rich alpha 2 glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4409
Species: Mu
Applications: WB
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-42526
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA, S-ELISA, ELISA(Cap), ELISA(Det)
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24664
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow

Publications for LRG1 Antibody (NBP1-82822) (0)

There are no publications for LRG1 Antibody (NBP1-82822).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRG1 Antibody (NBP1-82822) (0)

There are no reviews for LRG1 Antibody (NBP1-82822). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRG1 Antibody (NBP1-82822) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRG1 Products

Bioinformatics Tool for LRG1 Antibody (NBP1-82822)

Discover related pathways, diseases and genes to LRG1 Antibody (NBP1-82822). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRG1 Antibody (NBP1-82822)

Discover more about diseases related to LRG1 Antibody (NBP1-82822).
 

Pathways for LRG1 Antibody (NBP1-82822)

View related products by pathway.

PTMs for LRG1 Antibody (NBP1-82822)

Learn more about PTMs related to LRG1 Antibody (NBP1-82822).
 

Research Areas for LRG1 Antibody (NBP1-82822)

Find related products by research area.

Blogs on LRG1

There are no specific blogs for LRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRG1
Entrez