Home » LMW Kininogen » LMW Kininogen Antibodies » LMW Kininogen Antibody

LMW Kininogen Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: LMW Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and KNG1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: LMW Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and KNG1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human kidney using Anti-KNG1 antibody NBP1-89993.
Western Blot: LMW Kininogen Antibody [NBP1-89993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining in human kidney and skeletal muscle tissues.. Corresponding KNG1 RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human colon, kidney, prostate and testis using Anti-KNG1 antibody NBP1-89993 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human prostate.
Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human colon.
Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human testis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

LMW Kininogen Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETK
Specificity
Specificity of human LMW Kininogen antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KNG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LMW Kininogen Protein (NBP1-89993PEP)
Publications
Read Publication using NBP1-89993.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24648543)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMW Kininogen Antibody

  • Alpha-2-thiol proteinase inhibitor
  • BDK
  • bradykinin
  • Fitzgerald factor
  • High molecular weight kininogen
  • kininogen 1
  • kininogen
  • kininogen-1
  • KNGHMWK
  • Williams-Fitzgerald-Flaujeac factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Serpin
A8/Angiotensinogen An
NBP1-30027
Western Blot: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in human kidney lysate.
Immunocytochemistry/Immunofluorescence: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-Angiotensinogen at 10 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in mouse kidney using DAB with hematoxylin counterstain.
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
PLEKHM1 Antibody
NBP2-38449
Immunocytochemistry/Immunofluorescence: PLEKHM1 Antibody [NBP2-38449] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human small intestine shows moderate cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Substance P
Antibody
NB300-187
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Staining of trigeminal ganglia from P3-P5 rat pups. BMC Neuroscience 2010, 11:32doi:10.1186/1471-2202-11-32
Immunohistochemistry: Substance P Antibody [NB300-187] - Spinal Cord Dorsal Horn (Human).
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Detection of Substance P in rat spinal cord dorsal horn (red fluorescence). DAPI (blue) was used as counter stain.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Kallikrein
4/Prostase/EMSP1 Anti ...
MAB35661
Kallikrein 4/Prostase/EMSP1 was detected in immersion fixed paraffin-embedded sections of human prostate using Mouse Anti-Human Kallikrein 4/Prostase/EMSP1 Monoclonal Antibody (Catalog # MAB35661) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC, IP, Neut
DBT Antibody
(OTI1G2)
NBP2-02042
Western Blot: DBT Antibody (OTI1G2) [NBP2-02042] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DBT (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DBT.
Immunocytochemistry/Immunofluorescence: DBT Antibody (OTI1G2) [NBP2-02042] - Anti-DBT mouse monoclonal antibody (NBP2-02042) immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY DBT.
Flow Cytometry: DBT Antibody (OTI1G2) [NBP2-02042] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DBT antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, ICC/IF
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Plasma
Kallikrein/KLKB1 Anti ...
AF2498
Plasma Kallikrein/KLKB1 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: WB, IP
CD20 Antibody
(AISB12)
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow
SPANXB1 Antibody
H00728695-B01P
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF, IP
Kininogen Antibody
(207025) [Unconjugate ...
MAB1569
Kininogen was detected in immersion fixed paraffin-embedded sections of human brain (substantia nigra) using Mouse Anti-Human Kininogen Monoclonal Antibody (Catalog # MAB1569) at 0.5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and processes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Species: Hu
Applications: WB, IHC, IP
Factor XII Antibody
NBP1-94203
Western Blot: Factor XII/F12 Antibody [NBP1-94203] - WB analysis of F12 in 1. NIH 3T3 cell lysate and 2. Cos7 cell lysate.
Immunocytochemistry/Immunofluorescence: Factor XII Antibody [NBP1-94203] - F12 antibody was tested in NIH/3T3 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: Factor XII Antibody [NBP1-94203] - IHC analysis of F12 in human renal cancer using DAB with hematoxylin counterstain.
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Bradykinin
RB1/BDKRB1 Antibody
NLS799
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NLS799] - Analysis of anti-BDKRB1 antibody with human artery, smooth muscle, atherosclerosis at dilution 5 ug/ml.
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NLS799] - Analysis of anti-BDKRB1 with human artery, smooth musche, atherosclerosis at dilution 5 ug/ml.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Neprilysin/CD10
Antibody (SN75-07)
NBP2-67717
Western Blot: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of CD10 on Daudi cell lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunocytochemistry/Immunofluorescence: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Staining CD10 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of paraffin-embedded human tonsil tissue using anti-CD10 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: WB, IHC, IP, Neut
eNOS Antibody
NB300-500
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Expression of endothelial markers indicate functional endothelium in TEVG. Whole mount staining of native aorta and TEVG. VE-cadherin is a marker of cellular borders of endothelial cells (green). Endothelial nitric oxide synthase (eNOS) is a marker of a functional endothelium (red). DAPI is a nuclear stain (blue). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120328), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Mouse Carotid Artery stained with eNOS antibody. Image from verified customer review.
(3 Reviews)
(16 Publications)
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
Angiogenin [HRP]
DAN00
(20 Publications)
Species: Hu
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(37 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(30 Reviews)
(643 Publications)
Species: Hu
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for LMW Kininogen Antibody (NBP1-89993)(1)


Reviews for LMW Kininogen Antibody (NBP1-89993) (0)

There are no reviews for LMW Kininogen Antibody (NBP1-89993). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMW Kininogen Antibody (NBP1-89993) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional LMW Kininogen Products

Bioinformatics Tool for LMW Kininogen Antibody (NBP1-89993)

Discover related pathways, diseases and genes to LMW Kininogen Antibody (NBP1-89993). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMW Kininogen Antibody (NBP1-89993)

Discover more about diseases related to LMW Kininogen Antibody (NBP1-89993).
 

Pathways for LMW Kininogen Antibody (NBP1-89993)

View related products by pathway.

Research Areas for LMW Kininogen Antibody (NBP1-89993)

Find related products by research area.

Blogs on LMW Kininogen

There are no specific blogs for LMW Kininogen, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMW Kininogen Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KNG1