LMW Kininogen Antibody

Western Blot: LMW Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and KNG1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human testis.

Western Blot: LMW Kininogen Antibody [NBP1-89993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human kidney shows distinct membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining in human kidney and skeletal muscle tissues.. Corresponding KNG1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human colon, kidney, prostate and testis using Anti-KNG1 antibody NBP1-89993 (A) shows similar protein distribution across tissues to independent antibody NBP1-89994 (B).

Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human prostate.

Immunohistochemistry-Paraffin: LMW Kininogen Antibody [NBP1-89993] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

LMW Kininogen Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETK
• Specificity: Specificity of human LMW Kininogen antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KNG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24648543)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LMW Kininogen Antibody

• Alpha-2-thiol proteinase inhibitor
• BDK
• bradykinin
• Fitzgerald factor
• High molecular weight kininogen
• kininogen 1
• kininogen
• kininogen-1
• KNGHMWK
• Williams-Fitzgerald-Flaujeac factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LMW Kininogen Antibody (NBP1-89993)(1)

Publication using NBP1-89993

• Kampf C, Mardinoglu A, Fagerberg L et al. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. FASEB J 2014 Jul [PMID: 24648543]

Bioinformatics

• Gene Symbol: KNG1