Home » Kininogen » Kininogen Antibodies » Kininogen Antibody

Kininogen Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human kidney using Kininogen antibody NBP1-89993.
Western Blot: Kininogen Antibody [NBP1-89993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining in human kidney and skeletal muscle tissues.. Corresponding Kininogen RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human colon, kidney, prostate and testis using Kininogen antibody NBP1-89993 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human prostate.
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human colon.
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human testis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Kininogen Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETK
Specificity
Specificity of human Kininogen antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KNG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LMW Kininogen Protein (NBP1-89993PEP)
Publications
Read Publication using NBP1-89993.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kininogen Antibody

  • alpha 2-thiol Proteinase Inhibitor
  • BDK
  • Kininogen
  • KNG1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
PLEKHM1 Antibody
NBP2-38449
Immunocytochemistry/Immunofluorescence: PLEKHM1 Antibody [NBP2-38449] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human small intestine shows moderate cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Substance P
Antibody
NB300-187
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Staining of trigeminal ganglia from P3-P5 rat pups. BMC Neuroscience 2010, 11:32doi:10.1186/1471-2202-11-32
Immunohistochemistry: Substance P Antibody [NB300-187] - Spinal Cord Dorsal Horn (Human).
Immunocytochemistry/Immunofluorescence: Substance P Antibody [NB300-187] - Detection of Substance P in rat spinal cord dorsal horn (red fluorescence). DAPI (blue) was used as counter stain.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Kallikrein
4/Prostase/EMSP1 Anti ...
MAB35661
Kallikrein 4/Prostase/EMSP1 was detected in immersion fixed paraffin-embedded sections of human prostate using Mouse Anti-Human Kallikrein 4/Prostase/EMSP1 Monoclonal Antibody (Catalog # MAB35661) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC, IP, Neut
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Plasma
Kallikrein/KLKB1 Nati
NBP2-12555
SDS-Page: Plasma Kallikrein/KLKB1 Native Protein [NBP2-12555] - From left to right: Lane 1: Kallikrein - 10 ug (reduced / heated). Lane 2: Kallikrein - 20 ug (reduced / heated). Lane 3: LMW Standard (BIO-RAD Cat. No. 161-0304). Lane 4: Kallikrein - 10 ug (reduced / no heat). Lane 5: Kallikrein - 20 ug (reduced / no heat. Lane 6: Blank. Lane 7: Kallikrein - 10 ug (non-reduced / no heat). Lane 8: Kallikrein - 20 ug (non-reduced / no heat).
Species: Hu
CD20 Antibody (L26)
NBP2-44743
Western Blot: CD20 Antibody (L26) [NBP2-44743] - Western Blot Analysis of Raji cell lysate using CD20 Mouse Monoclonal Antibody (L26).
Immunocytochemistry/Immunofluorescence: CD20 Antibody (L26) [NBP2-44743] - Immunofluorescence staining of Raji cells using CD20 Mouse Monoclonal Antibody (L26) followed by goat anti-Mouse IgG conjugated to CF488 (green). Nuclei are stained with Reddot.
Immunohistochemistry-Paraffin: MS4A1/CD20 Antibody (L26) [NBP2-44743] - Human Lymphoma stained with CD20 Monoclonal Antibody (L26)
(1 Publication)
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
SPANXB1 Antibody
H00728695-B01P
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF, IP
Kininogen Antibody
NBP1-89993
Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human kidney using Kininogen antibody NBP1-89993.
Western Blot: Kininogen Antibody [NBP1-89993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Factor XII Antibody
NBP1-94203
Western Blot: Factor XII/F12 Antibody [NBP1-94203] - WB analysis of F12 in 1. NIH 3T3 cell lysate and 2. Cos7 cell lysate.
Immunocytochemistry/Immunofluorescence: Factor XII Antibody [NBP1-94203] - F12 antibody was tested in NIH/3T3 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: Factor XII Antibody [NBP1-94203] - IHC analysis of F12 in human renal cancer using DAB with hematoxylin counterstain.
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Bradykinin
RB1/BDKRB1 Antibody
NLS799
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NLS799] - Brain Hippocampus Neurons
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NLS799] - Analysis of anti-BDKRB1 with human artery, smooth musche, atherosclerosis at dilution 5 ug/ml.
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NLS799] - Analysis of anti-BDKRB1 antibody with human artery, smooth muscle, atherosclerosis at dilution 5 ug/ml.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Neprilysin/CD10
Antibody (SN75-07)
NBP2-67717
Western Blot: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of CD10 on Daudi cell lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunocytochemistry/Immunofluorescence: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Staining CD10 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of paraffin-embedded human tonsil tissue using anti-CD10 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Renin Antibody
(OTI2F10)
NBP2-45552
Western Blot: Renin Antibody (2F10) [NBP2-45552] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Renin.
Immunohistochemistry: Renin Antibody (2F10) [NBP2-45552] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: Renin Antibody (2F10) [NBP2-45552] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: WB, IHC
eNOS Antibody
NB300-500
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Expression of endothelial markers indicate functional endothelium in TEVG. Whole mount staining of native aorta and TEVG. VE-cadherin is a marker of cellular borders of endothelial cells (green). Endothelial nitric oxide synthase (eNOS) is a marker of a functional endothelium (red). DAPI is a nuclear stain (blue). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120328), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Mouse Carotid Artery stained with eNOS antibody. Image from verified customer review.
(3 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
Angiogenin [HRP]
DAN00
(20 Publications)
Species: Hu
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(39 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for Kininogen Antibody (NBP1-89993)(1)


Reviews for Kininogen Antibody (NBP1-89993) (0)

There are no reviews for Kininogen Antibody (NBP1-89993). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kininogen Antibody (NBP1-89993) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Kininogen Products

Bioinformatics Tool for Kininogen Antibody (NBP1-89993)

Discover related pathways, diseases and genes to Kininogen Antibody (NBP1-89993). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kininogen Antibody (NBP1-89993)

Discover more about diseases related to Kininogen Antibody (NBP1-89993).
 

Pathways for Kininogen Antibody (NBP1-89993)

View related products by pathway.

Research Areas for Kininogen Antibody (NBP1-89993)

Find related products by research area.

Blogs on Kininogen

There are no specific blogs for Kininogen, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kininogen Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KNG1