Kininogen Antibody

Images

 
Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human kidney using Kininogen antibody NBP1-89993.
Western Blot: Kininogen Antibody [NBP1-89993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining in human kidney and skeletal muscle tissues.. Corresponding Kininogen RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human colon, kidney, prostate and testis using Kininogen antibody NBP1-89993 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human prostate.
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human colon.
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human testis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kininogen Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETK
Specificity
Specificity of human Kininogen antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KNG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LMW Kininogen Protein (NBP1-89993PEP)
Publications
Read Publication using NBP1-89993.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kininogen Antibody

  • alpha 2-thiol Proteinase Inhibitor
  • BDK
  • Kininogen
  • KNG1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12555
Species: Hu
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NLS799
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45552
Species: Hu
Applications: WB, IHC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for Kininogen Antibody (NBP1-89993)(1)

Reviews for Kininogen Antibody (NBP1-89993) (0)

There are no reviews for Kininogen Antibody (NBP1-89993). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kininogen Antibody (NBP1-89993) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Kininogen Products

Bioinformatics Tool for Kininogen Antibody (NBP1-89993)

Discover related pathways, diseases and genes to Kininogen Antibody (NBP1-89993). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kininogen Antibody (NBP1-89993)

Discover more about diseases related to Kininogen Antibody (NBP1-89993).
 

Pathways for Kininogen Antibody (NBP1-89993)

View related products by pathway.

Research Areas for Kininogen Antibody (NBP1-89993)

Find related products by research area.

Blogs on Kininogen

There are no specific blogs for Kininogen, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kininogen Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KNG1