LLGL2 Antibody (4G2)

Images

 
Western Blot: LLGL2 Antibody (4G2) [H00003993-M06] - Analysis of LLGL2 expression in transfected 293T cell line by LLGL2 monoclonal antibody (M06), clone 4G2. Lane 1: LLGL2 transfected lysatE (113 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: LLGL2 Antibody (4G2) [H00003993-M06] - Analysis of monoclonal antibody to LLGL2 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 1 ug/ml
Sandwich ELISA: LLGL2 Antibody (4G2) [H00003993-M06] - Detection limit for recombinant GST tagged LLGL2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LLGL2 Antibody (4G2) Summary

Immunogen
LLGL2 (NP_004515, 101 a.a. - 199 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR
Specificity
Human LLGL2 (4G2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LLGL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publications using
H00003993-M06 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LLGL2 Antibody (4G2)

  • HGLlethal giant larvae (Drosophila) homolog 2
  • human giant larvae homolog
  • lethal giant larvae homolog 2 (Drosophila)
  • lethal(2) giant larvae protein homolog 2
  • LGL2

Background

The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60930
Species: Hu, Mu
Applications: WB
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56176
Species: Hu
Applications: ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-91288
Species: Mu
Applications: IHC, IHC-P
NBP1-82243
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81829
Species: Hu
Applications: WB, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
H00023179-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00003996-M01
Species: Hu
Applications: WB, ELISA
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00003993-M06
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for LLGL2 Antibody (H00003993-M06)(7)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for LLGL2 Antibody (H00003993-M06) (0)

There are no reviews for LLGL2 Antibody (H00003993-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LLGL2 Antibody (H00003993-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LLGL2 Products

Bioinformatics Tool for LLGL2 Antibody (H00003993-M06)

Discover related pathways, diseases and genes to LLGL2 Antibody (H00003993-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LLGL2 Antibody (H00003993-M06)

Discover more about diseases related to LLGL2 Antibody (H00003993-M06).
 

Pathways for LLGL2 Antibody (H00003993-M06)

View related products by pathway.

Blogs on LLGL2

There are no specific blogs for LLGL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LLGL2 Antibody (4G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol LLGL2
Entrez
Uniprot