LITAF Antibody

Images

 
Western Blot: LITAF Antibody [NBP1-83473] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: LITAF Antibody [NBP1-83473] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LITAF Antibody [NBP1-83473] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LITAF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNC
Specificity
Specificity of human LITAF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LITAF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
LITAF Lysate (NBP2-65160)
Control Peptide
LITAF Protein (NBP1-83473PEP)
Publications
Read Publication using NBP1-83473.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%). Reactivity reported in scientific literature (PMID: 23576546)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LITAF Antibody

  • CMT1C
  • FLJ38636
  • lipopolysaccharide-induced TNF factor
  • lipopolysaccharide-induced TNF-alpha factor
  • lipopolysaccharide-induced tumor necrosis factor-alpha factor
  • LITAF
  • LPS-induced TNF-alpha factor
  • MGC116698
  • MGC116700
  • MGC125275
  • MGC125276
  • p53-induced gene 7 protein
  • PIG7
  • PIG7MGC116701
  • SIMPLE
  • SIMPLEMGC125274
  • Small integral membrane protein of lysosome/late endosome
  • TP53I7
  • tumor protein p53 inducible protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBL1-15012
Species: Hu
7270-IL/CF
Species: Hu
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-66383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-66813
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NB300-131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LITAF Antibody (NBP1-83473)(1)


Reviews for LITAF Antibody (NBP1-83473) (0)

There are no reviews for LITAF Antibody (NBP1-83473). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LITAF Antibody (NBP1-83473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for LITAF Antibody (NBP1-83473)

Discover related pathways, diseases and genes to LITAF Antibody (NBP1-83473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LITAF Antibody (NBP1-83473)

Discover more about diseases related to LITAF Antibody (NBP1-83473).
 

Pathways for LITAF Antibody (NBP1-83473)

View related products by pathway.

PTMs for LITAF Antibody (NBP1-83473)

Learn more about PTMs related to LITAF Antibody (NBP1-83473).
 

Research Areas for LITAF Antibody (NBP1-83473)

Find related products by research area.

Blogs on LITAF

There are no specific blogs for LITAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LITAF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LITAF