LITAF Antibody - BSA Free

Western Blot: LITAF Antibody [NBP1-83473] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: LITAF Antibody [NBP1-83473] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LITAF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LITAF Antibody - BSA Free (NBP1-83473) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-LITAF Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: APPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LITAF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LITAF Protein (NBP1-83473PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (89%). Reactivity reported in scientific literature (PMID: 23576546)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LITAF Antibody - BSA Free

• CMT1C
• FLJ38636
• lipopolysaccharide-induced TNF factor
• lipopolysaccharide-induced TNF-alpha factor
• lipopolysaccharide-induced tumor necrosis factor-alpha factor
• LITAF
• LPS-induced TNF-alpha factor
• MGC116698
• MGC116700
• MGC125275
• MGC125276
• p53-induced gene 7 protein
• PIG7
• PIG7MGC116701
• SIMPLE
• SIMPLEMGC125274
• Small integral membrane protein of lysosome/late endosome
• TP53I7
• tumor protein p53 inducible protein 7

Background

Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppresor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LITAF Antibody (NBP1-83473)(1)

Publication using NBP1-83473

• Zhu H, Guariglia S, Yu RY et al. Mutation of SIMPLE in Charcot-Marie-Tooth 1C alters production of exosomes. Mol Biol Cell 2013-06-01 [PMID: 23576546]

Bioinformatics

• Gene Symbol: LITAF